-
Global information
- Generated on Sun May 10 04:15:05 2026
- Log file: /project/archive/log/postgres/dbprd51/postgresql.log-20260509
- Parsed 114,805 log entries in 4s
- Log start from 2026-05-03 00:00:01 to 2026-05-09 23:57:21
-
Overview
Global Stats
- 110 Number of unique normalized queries
- 525 Number of queries
- 7h1m38s Total query duration
- 2026-05-03 00:09:19 First query
- 2026-05-09 23:23:22 Last query
- 3 queries/s at 2026-05-03 03:40:12 Query peak
- 7h1m38s Total query duration
- 0ms Prepare/parse total duration
- 0ms Bind total duration
- 7h1m38s Execute total duration
- 60 Number of events
- 17 Number of unique normalized events
- 18 Max number of times the same event was reported
- 0 Number of cancellation
- 41 Total number of automatic vacuums
- 161 Total number of automatic analyzes
- 4 Number temporary file
- 2.01 MiB Max size of temporary file
- 1.23 MiB Average size of temporary file
- 13,865 Total number of sessions
- 60 sessions at 2026-05-06 01:24:58 Session peak
- 732d16h35m53s Total duration of sessions
- 1h16m5s Average duration of sessions
- 0 Average queries per session
- 1s824ms Average queries duration per session
- 1h16m3s Average idle time per session
- 13,866 Total number of connections
- 9 connections/s at 2026-05-03 03:46:26 Connection peak
- 2 Total number of databases
SQL Traffic
Key values
- 3 queries/s Query Peak
- 2026-05-03 03:40:12 Date
SELECT Traffic
Key values
- 3 queries/s Query Peak
- 2026-05-03 03:40:12 Date
INSERT/UPDATE/DELETE Traffic
Key values
- 1 queries/s Query Peak
- 2026-05-07 14:00:52 Date
Queries duration
Key values
- 7h1m38s Total query duration
Prepared queries ratio
Key values
- 0.00 Ratio of bind vs prepare
- 0.00 % Ratio between prepared and "usual" statements
General Activity
↑ Back to the top of the General Activity tableDay Hour Count Min duration Max duration Avg duration Latency Percentile(90) Latency Percentile(95) Latency Percentile(99) May 03 00 2 0ms 9m17s 4m42s 0ms 0ms 9m24s 01 12 0ms 5s935ms 5s519ms 0ms 0ms 1m6s 02 0 0ms 0ms 0ms 0ms 0ms 0ms 03 18 0ms 5m52s 1m32s 16s739ms 2m6s 23m16s 04 0 0ms 0ms 0ms 0ms 0ms 0ms 05 7 0ms 34s785ms 22s181ms 5s685ms 55s59ms 1m2s 06 1 0ms 5s522ms 5s522ms 0ms 0ms 5s522ms 07 0 0ms 0ms 0ms 0ms 0ms 0ms 08 1 0ms 5s670ms 5s670ms 0ms 0ms 5s670ms 09 0 0ms 0ms 0ms 0ms 0ms 0ms 10 0 0ms 0ms 0ms 0ms 0ms 0ms 11 10 0ms 43s116ms 25s368ms 27s230ms 43s116ms 1m1s 12 0 0ms 0ms 0ms 0ms 0ms 0ms 13 0 0ms 0ms 0ms 0ms 0ms 0ms 14 0 0ms 0ms 0ms 0ms 0ms 0ms 15 0 0ms 0ms 0ms 0ms 0ms 0ms 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 0 0ms 0ms 0ms 0ms 0ms 0ms 18 0 0ms 0ms 0ms 0ms 0ms 0ms 19 0 0ms 0ms 0ms 0ms 0ms 0ms 20 0 0ms 0ms 0ms 0ms 0ms 0ms 21 0 0ms 0ms 0ms 0ms 0ms 0ms 22 0 0ms 0ms 0ms 0ms 0ms 0ms 23 5 0ms 2m3s 55s277ms 16s572ms 1m37s 2m3s May 04 00 5 0ms 9m17s 1m56s 0ms 12s529ms 9m23s 01 0 0ms 0ms 0ms 0ms 0ms 0ms 02 0 0ms 0ms 0ms 0ms 0ms 0ms 03 1 0ms 10s7ms 10s7ms 0ms 0ms 10s7ms 04 4 0ms 1m54s 50s355ms 0ms 28s201ms 1m54s 05 4 0ms 27s365ms 11s90ms 0ms 5s625ms 27s365ms 06 12 0ms 1m51s 20s755ms 12s777ms 39s299ms 1m51s 07 0 0ms 0ms 0ms 0ms 0ms 0ms 08 1 0ms 7s23ms 7s23ms 0ms 0ms 7s23ms 09 0 0ms 0ms 0ms 0ms 0ms 0ms 10 9 0ms 1m51s 24s354ms 20s869ms 47s569ms 1m51s 11 2 0ms 7s264ms 6s321ms 0ms 0ms 12s643ms 12 1 0ms 5s232ms 5s232ms 0ms 0ms 5s232ms 13 12 0ms 8s455ms 5s748ms 5s541ms 7s448ms 10s784ms 14 40 0ms 1m52s 9s877ms 11s175ms 39s519ms 1m52s 15 0 0ms 0ms 0ms 0ms 0ms 0ms 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 0 0ms 0ms 0ms 0ms 0ms 0ms 18 9 0ms 1m51s 24s380ms 20s919ms 47s726ms 1m51s 19 3 0ms 7s219ms 7s47ms 0ms 0ms 21s142ms 20 0 0ms 0ms 0ms 0ms 0ms 0ms 21 0 0ms 0ms 0ms 0ms 0ms 0ms 22 0 0ms 0ms 0ms 0ms 0ms 0ms 23 0 0ms 0ms 0ms 0ms 0ms 0ms May 05 00 8 0ms 9m14s 1m19s 12s133ms 12s705ms 9m20s 01 5 0ms 9s394ms 9s182ms 0ms 18s374ms 27s539ms 02 0 0ms 0ms 0ms 0ms 0ms 0ms 03 0 0ms 0ms 0ms 0ms 0ms 0ms 04 3 0ms 2m12s 1m36s 0ms 26s92ms 2m12s 05 3 0ms 6s235ms 5s779ms 0ms 5s593ms 6s235ms 06 16 0ms 1m51s 21s12ms 31s316ms 41s771ms 1m51s 07 5 0ms 34s529ms 27s744ms 0ms 31s505ms 1m8s 08 0 0ms 0ms 0ms 0ms 0ms 0ms 09 0 0ms 0ms 0ms 0ms 0ms 0ms 10 11 0ms 1m52s 21s159ms 6s247ms 39s582ms 1m58s 11 0 0ms 0ms 0ms 0ms 0ms 0ms 12 0 0ms 0ms 0ms 0ms 0ms 0ms 13 0 0ms 0ms 0ms 0ms 0ms 0ms 14 9 0ms 1m51s 24s403ms 20s856ms 47s434ms 1m51s 15 0 0ms 0ms 0ms 0ms 0ms 0ms 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 0 0ms 0ms 0ms 0ms 0ms 0ms 18 9 0ms 1m51s 24s387ms 20s853ms 47s622ms 1m51s 19 0 0ms 0ms 0ms 0ms 0ms 0ms 20 0 0ms 0ms 0ms 0ms 0ms 0ms 21 0 0ms 0ms 0ms 0ms 0ms 0ms 22 0 0ms 0ms 0ms 0ms 0ms 0ms 23 0 0ms 0ms 0ms 0ms 0ms 0ms May 06 00 3 0ms 9m18s 3m10s 0ms 5s414ms 9m25s 01 1 0ms 6s965ms 6s965ms 0ms 0ms 6s965ms 02 0 0ms 0ms 0ms 0ms 0ms 0ms 03 0 0ms 0ms 0ms 0ms 0ms 0ms 04 0 0ms 0ms 0ms 0ms 0ms 0ms 05 2 0ms 5s589ms 5s573ms 0ms 0ms 5s589ms 06 9 0ms 1m51s 24s341ms 20s889ms 47s471ms 1m51s 07 5 0ms 9s269ms 8s392ms 5s67ms 9s184ms 18s529ms 08 0 0ms 0ms 0ms 0ms 0ms 0ms 09 4 0ms 6s228ms 6s210ms 0ms 6s199ms 6s228ms 10 9 0ms 1m51s 24s428ms 0ms 39s614ms 1m51s 11 1 0ms 6s192ms 6s192ms 0ms 0ms 6s192ms 12 14 0ms 1m9s 38s535ms 27s494ms 2m1s 2m30s 13 0 0ms 0ms 0ms 0ms 0ms 0ms 14 9 0ms 1m51s 24s415ms 20s832ms 47s341ms 1m51s 15 2 0ms 6s272ms 5s992ms 0ms 5s713ms 6s272ms 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 0 0ms 0ms 0ms 0ms 0ms 0ms 18 9 0ms 1m52s 24s464ms 20s868ms 47s449ms 1m52s 19 0 0ms 0ms 0ms 0ms 0ms 0ms 20 1 0ms 5s2ms 5s2ms 0ms 0ms 5s2ms 21 2 0ms 5s155ms 5s148ms 0ms 0ms 10s297ms 22 0 0ms 0ms 0ms 0ms 0ms 0ms 23 0 0ms 0ms 0ms 0ms 0ms 0ms May 07 00 2 0ms 12m16s 6m11s 0ms 0ms 12m23s 01 1 0ms 12s34ms 12s34ms 0ms 0ms 12s34ms 02 0 0ms 0ms 0ms 0ms 0ms 0ms 03 1 0ms 6s945ms 6s945ms 0ms 0ms 6s945ms 04 0 0ms 0ms 0ms 0ms 0ms 0ms 05 2 0ms 5s751ms 5s630ms 0ms 5s510ms 5s751ms 06 12 0ms 1m52s 26s395ms 32s474ms 39s445ms 1m52s 07 4 0ms 32s83ms 20s563ms 0ms 10s294ms 32s83ms 08 0 0ms 0ms 0ms 0ms 0ms 0ms 09 2 0ms 11s585ms 11s517ms 0ms 11s449ms 11s585ms 10 11 0ms 1m52s 22s108ms 0ms 43s779ms 1m52s 11 0 0ms 0ms 0ms 0ms 0ms 0ms 12 1 0ms 5s61ms 5s61ms 0ms 0ms 5s61ms 13 0 0ms 0ms 0ms 0ms 0ms 0ms 14 9 0ms 1m51s 24s486ms 21s181ms 47s948ms 1m51s 15 2 0ms 17s552ms 16s613ms 0ms 15s673ms 17s552ms 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 0 0ms 0ms 0ms 0ms 0ms 0ms 18 9 0ms 1m52s 24s490ms 20s932ms 47s750ms 1m52s 19 0 0ms 0ms 0ms 0ms 0ms 0ms 20 0 0ms 0ms 0ms 0ms 0ms 0ms 21 1 0ms 5s86ms 5s86ms 0ms 0ms 5s86ms 22 0 0ms 0ms 0ms 0ms 0ms 0ms 23 0 0ms 0ms 0ms 0ms 0ms 0ms May 08 00 2 0ms 9m17s 4m42s 0ms 0ms 9m24s 01 0 0ms 0ms 0ms 0ms 0ms 0ms 02 2 0ms 5s918ms 5s860ms 0ms 0ms 5s918ms 03 1 0ms 5s960ms 5s960ms 0ms 0ms 5s960ms 04 0 0ms 0ms 0ms 0ms 0ms 0ms 05 2 0ms 5s521ms 5s507ms 0ms 5s493ms 5s521ms 06 9 0ms 1m51s 24s375ms 20s914ms 47s667ms 1m51s 07 2 0ms 28s593ms 28s255ms 0ms 27s918ms 28s593ms 08 14 0ms 14m5s 2m14s 57s600ms 13m53s 14m5s 09 0 0ms 0ms 0ms 0ms 0ms 0ms 10 9 0ms 1m53s 24s648ms 21s113ms 47s594ms 1m53s 11 3 0ms 13m31s 4m58s 0ms 45s923ms 13m31s 12 1 0ms 6s749ms 6s749ms 0ms 0ms 6s749ms 13 2 0ms 6s642ms 6s74ms 0ms 5s506ms 6s642ms 14 12 0ms 6m44s 52s881ms 39s292ms 1m51s 6m44s 15 9 0ms 6m52s 1m48s 29s18ms 49s753ms 6m52s 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 0 0ms 0ms 0ms 0ms 0ms 0ms 18 9 0ms 1m52s 24s481ms 0ms 39s596ms 1m52s 19 0 0ms 0ms 0ms 0ms 0ms 0ms 20 0 0ms 0ms 0ms 0ms 0ms 0ms 21 4 0ms 5s524ms 5s409ms 0ms 5s235ms 16s403ms 22 9 0ms 26s755ms 10s558ms 9s46ms 26s755ms 38s48ms 23 4 0ms 9s383ms 9s2ms 0ms 9s197ms 18s601ms May 09 00 2 0ms 9m19s 4m43s 0ms 0ms 9m26s 01 1 0ms 9s573ms 9s573ms 0ms 0ms 9s573ms 02 0 0ms 0ms 0ms 0ms 0ms 0ms 03 0 0ms 0ms 0ms 0ms 0ms 0ms 04 0 0ms 0ms 0ms 0ms 0ms 0ms 05 5 0ms 8s804ms 6s825ms 5s507ms 8s794ms 8s804ms 06 0 0ms 0ms 0ms 0ms 0ms 0ms 07 3 0ms 26s318ms 17s988ms 0ms 26s318ms 27s646ms 08 1 0ms 8s313ms 8s313ms 0ms 0ms 8s313ms 09 0 0ms 0ms 0ms 0ms 0ms 0ms 10 0 0ms 0ms 0ms 0ms 0ms 0ms 11 1 0ms 26s262ms 26s262ms 0ms 0ms 26s262ms 12 1 0ms 10s595ms 10s595ms 0ms 0ms 10s595ms 13 0 0ms 0ms 0ms 0ms 0ms 0ms 14 3 0ms 5s553ms 5s381ms 0ms 0ms 16s145ms 15 0 0ms 0ms 0ms 0ms 0ms 0ms 16 0 0ms 0ms 0ms 0ms 0ms 0ms 17 1 0ms 6s48ms 6s48ms 0ms 0ms 6s48ms 18 31 0ms 26m52s 1m32s 1m20s 2m12s 26m52s 19 23 0ms 27m2s 2m4s 1m41s 7m15s 27m2s 20 0 0ms 0ms 0ms 0ms 0ms 0ms 21 0 0ms 0ms 0ms 0ms 0ms 0ms 22 1 0ms 5s831ms 5s831ms 0ms 0ms 5s831ms 23 2 0ms 15m9s 14m42s 0ms 14m14s 15m9s Day Hour SELECT COPY TO Average Duration Latency Percentile(90) Latency Percentile(95) Latency Percentile(99) May 03 00 1 0 9m17s 0ms 0ms 9m17s 01 12 0 5s519ms 0ms 0ms 1m6s 02 0 0 0ms 0ms 0ms 0ms 03 18 0 1m32s 0ms 16s739ms 23m16s 04 0 0 0ms 0ms 0ms 0ms 05 7 0 22s181ms 0ms 5s685ms 1m2s 06 1 0 5s522ms 0ms 0ms 5s522ms 07 0 0 0ms 0ms 0ms 0ms 08 1 0 5s670ms 0ms 0ms 5s670ms 09 0 0 0ms 0ms 0ms 0ms 10 0 0 0ms 0ms 0ms 0ms 11 10 0 25s368ms 0ms 27s230ms 1m1s 12 0 0 0ms 0ms 0ms 0ms 13 0 0 0ms 0ms 0ms 0ms 14 0 0 0ms 0ms 0ms 0ms 15 0 0 0ms 0ms 0ms 0ms 16 0 0 0ms 0ms 0ms 0ms 17 0 0 0ms 0ms 0ms 0ms 18 0 0 0ms 0ms 0ms 0ms 19 0 0 0ms 0ms 0ms 0ms 20 0 0 0ms 0ms 0ms 0ms 21 0 0 0ms 0ms 0ms 0ms 22 0 0 0ms 0ms 0ms 0ms 23 5 0 55s277ms 0ms 16s572ms 2m3s May 04 00 4 0 2m23s 0ms 0ms 9m17s 01 0 0 0ms 0ms 0ms 0ms 02 0 0 0ms 0ms 0ms 0ms 03 1 0 10s7ms 0ms 0ms 10s7ms 04 4 0 50s355ms 0ms 0ms 1m54s 05 4 0 11s90ms 0ms 0ms 27s365ms 06 3 9 20s755ms 0ms 12s777ms 1m51s 07 0 0 0ms 0ms 0ms 0ms 08 1 0 7s23ms 0ms 0ms 7s23ms 09 0 0 0ms 0ms 0ms 0ms 10 0 9 24s354ms 0ms 20s869ms 1m51s 11 2 0 6s321ms 0ms 0ms 12s643ms 12 1 0 5s232ms 0ms 0ms 5s232ms 13 12 0 5s748ms 5s58ms 5s541ms 10s784ms 14 31 9 9s877ms 10s356ms 13s463ms 1m52s 15 0 0 0ms 0ms 0ms 0ms 16 0 0 0ms 0ms 0ms 0ms 17 0 0 0ms 0ms 0ms 0ms 18 0 9 24s380ms 0ms 20s919ms 1m51s 19 3 0 7s47ms 0ms 0ms 21s142ms 20 0 0 0ms 0ms 0ms 0ms 21 0 0 0ms 0ms 0ms 0ms 22 0 0 0ms 0ms 0ms 0ms 23 0 0 0ms 0ms 0ms 0ms May 05 00 7 0 1m29s 0ms 12s133ms 9m14s 01 5 0 9s182ms 0ms 0ms 27s539ms 02 0 0 0ms 0ms 0ms 0ms 03 0 0 0ms 0ms 0ms 0ms 04 3 0 1m36s 0ms 0ms 2m12s 05 3 0 5s779ms 0ms 0ms 6s235ms 06 7 9 21s12ms 5s611ms 31s316ms 1m51s 07 5 0 27s744ms 0ms 0ms 1m8s 08 0 0 0ms 0ms 0ms 0ms 09 0 0 0ms 0ms 0ms 0ms 10 2 9 21s159ms 0ms 6s286ms 1m52s 11 0 0 0ms 0ms 0ms 0ms 12 0 0 0ms 0ms 0ms 0ms 13 0 0 0ms 0ms 0ms 0ms 14 0 9 24s403ms 0ms 20s856ms 1m51s 15 0 0 0ms 0ms 0ms 0ms 16 0 0 0ms 0ms 0ms 0ms 17 0 0 0ms 0ms 0ms 0ms 18 0 9 24s387ms 0ms 20s853ms 1m51s 19 0 0 0ms 0ms 0ms 0ms 20 0 0 0ms 0ms 0ms 0ms 21 0 0 0ms 0ms 0ms 0ms 22 0 0 0ms 0ms 0ms 0ms 23 0 0 0ms 0ms 0ms 0ms May 06 00 2 0 4m41s 0ms 0ms 9m18s 01 1 0 6s965ms 0ms 0ms 6s965ms 02 0 0 0ms 0ms 0ms 0ms 03 0 0 0ms 0ms 0ms 0ms 04 0 0 0ms 0ms 0ms 0ms 05 2 0 5s573ms 0ms 0ms 5s589ms 06 0 9 24s341ms 0ms 20s889ms 1m51s 07 5 0 8s392ms 0ms 5s67ms 18s529ms 08 0 0 0ms 0ms 0ms 0ms 09 4 0 6s210ms 0ms 0ms 6s228ms 10 0 9 24s428ms 0ms 0ms 1m51s 11 1 0 6s192ms 0ms 0ms 6s192ms 12 14 0 38s535ms 0ms 27s494ms 2m30s 13 0 0 0ms 0ms 0ms 0ms 14 0 9 24s415ms 0ms 20s832ms 1m51s 15 2 0 5s992ms 0ms 0ms 6s272ms 16 0 0 0ms 0ms 0ms 0ms 17 0 0 0ms 0ms 0ms 0ms 18 0 9 24s464ms 0ms 20s868ms 1m52s 19 0 0 0ms 0ms 0ms 0ms 20 1 0 5s2ms 0ms 0ms 5s2ms 21 2 0 5s148ms 0ms 0ms 10s297ms 22 0 0 0ms 0ms 0ms 0ms 23 0 0 0ms 0ms 0ms 0ms May 07 00 1 0 12m16s 0ms 0ms 12m16s 01 1 0 12s34ms 0ms 0ms 12s34ms 02 0 0 0ms 0ms 0ms 0ms 03 1 0 6s945ms 0ms 0ms 6s945ms 04 0 0 0ms 0ms 0ms 0ms 05 2 0 5s630ms 0ms 0ms 5s751ms 06 3 9 26s395ms 0ms 32s474ms 1m52s 07 4 0 20s563ms 0ms 0ms 31s55ms 08 0 0 0ms 0ms 0ms 0ms 09 2 0 11s517ms 0ms 0ms 11s585ms 10 2 9 22s108ms 0ms 21s22ms 1m52s 11 0 0 0ms 0ms 0ms 0ms 12 1 0 5s61ms 0ms 0ms 5s61ms 13 0 0 0ms 0ms 0ms 0ms 14 0 9 24s486ms 0ms 21s181ms 1m51s 15 2 0 16s613ms 0ms 0ms 17s552ms 16 0 0 0ms 0ms 0ms 0ms 17 0 0 0ms 0ms 0ms 0ms 18 0 9 24s490ms 0ms 20s932ms 1m52s 19 0 0 0ms 0ms 0ms 0ms 20 0 0 0ms 0ms 0ms 0ms 21 1 0 5s86ms 0ms 0ms 5s86ms 22 0 0 0ms 0ms 0ms 0ms 23 0 0 0ms 0ms 0ms 0ms May 08 00 1 0 9m17s 0ms 0ms 9m17s 01 0 0 0ms 0ms 0ms 0ms 02 2 0 5s860ms 0ms 0ms 5s918ms 03 1 0 5s960ms 0ms 0ms 5s960ms 04 0 0 0ms 0ms 0ms 0ms 05 2 0 5s507ms 0ms 0ms 5s521ms 06 0 9 24s375ms 0ms 20s914ms 1m51s 07 2 0 28s255ms 0ms 0ms 28s593ms 08 14 0 2m14s 0ms 57s600ms 14m5s 09 0 0 0ms 0ms 0ms 0ms 10 0 9 24s648ms 0ms 21s113ms 1m53s 11 3 0 4m58s 0ms 0ms 13m31s 12 1 0 6s749ms 0ms 0ms 6s749ms 13 2 0 6s74ms 0ms 0ms 6s642ms 14 3 9 52s881ms 0ms 39s292ms 6m44s 15 9 0 1m48s 0ms 29s18ms 6m52s 16 0 0 0ms 0ms 0ms 0ms 17 0 0 0ms 0ms 0ms 0ms 18 0 9 24s481ms 0ms 0ms 1m52s 19 0 0 0ms 0ms 0ms 0ms 20 0 0 0ms 0ms 0ms 0ms 21 4 0 5s409ms 0ms 0ms 16s403ms 22 9 0 10s558ms 0ms 9s46ms 38s48ms 23 4 0 9s2ms 0ms 0ms 18s601ms May 09 00 1 0 9m19s 0ms 0ms 9m19s 01 1 0 9s573ms 0ms 0ms 9s573ms 02 0 0 0ms 0ms 0ms 0ms 03 0 0 0ms 0ms 0ms 0ms 04 0 0 0ms 0ms 0ms 0ms 05 5 0 6s825ms 0ms 5s507ms 8s804ms 06 0 0 0ms 0ms 0ms 0ms 07 3 0 17s988ms 0ms 0ms 27s646ms 08 1 0 8s313ms 0ms 0ms 8s313ms 09 0 0 0ms 0ms 0ms 0ms 10 0 0 0ms 0ms 0ms 0ms 11 1 0 26s262ms 0ms 0ms 26s262ms 12 1 0 10s595ms 0ms 0ms 10s595ms 13 0 0 0ms 0ms 0ms 0ms 14 3 0 5s381ms 0ms 0ms 16s145ms 15 0 0 0ms 0ms 0ms 0ms 16 0 0 0ms 0ms 0ms 0ms 17 1 0 6s48ms 0ms 0ms 6s48ms 18 0 31 1m32s 54s897ms 1m20s 26m52s 19 0 23 2m4s 1m2s 1m41s 27m2s 20 0 0 0ms 0ms 0ms 0ms 21 0 0 0ms 0ms 0ms 0ms 22 1 0 5s831ms 0ms 0ms 5s831ms 23 2 0 14m42s 0ms 0ms 15m9s Day Hour INSERT UPDATE DELETE COPY FROM Average Duration Latency Percentile(90) Latency Percentile(95) Latency Percentile(99) May 03 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms May 04 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms May 05 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms May 06 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms May 07 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms May 08 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms May 09 00 0 0 0 0 0ms 0ms 0ms 0ms 01 0 0 0 0 0ms 0ms 0ms 0ms 02 0 0 0 0 0ms 0ms 0ms 0ms 03 0 0 0 0 0ms 0ms 0ms 0ms 04 0 0 0 0 0ms 0ms 0ms 0ms 05 0 0 0 0 0ms 0ms 0ms 0ms 06 0 0 0 0 0ms 0ms 0ms 0ms 07 0 0 0 0 0ms 0ms 0ms 0ms 08 0 0 0 0 0ms 0ms 0ms 0ms 09 0 0 0 0 0ms 0ms 0ms 0ms 10 0 0 0 0 0ms 0ms 0ms 0ms 11 0 0 0 0 0ms 0ms 0ms 0ms 12 0 0 0 0 0ms 0ms 0ms 0ms 13 0 0 0 0 0ms 0ms 0ms 0ms 14 0 0 0 0 0ms 0ms 0ms 0ms 15 0 0 0 0 0ms 0ms 0ms 0ms 16 0 0 0 0 0ms 0ms 0ms 0ms 17 0 0 0 0 0ms 0ms 0ms 0ms 18 0 0 0 0 0ms 0ms 0ms 0ms 19 0 0 0 0 0ms 0ms 0ms 0ms 20 0 0 0 0 0ms 0ms 0ms 0ms 21 0 0 0 0 0ms 0ms 0ms 0ms 22 0 0 0 0 0ms 0ms 0ms 0ms 23 0 0 0 0 0ms 0ms 0ms 0ms Day Hour Prepare Bind Bind/Prepare Percentage of prepare May 03 00 0 0 0.00 0.00% 01 0 12 12.00 0.00% 02 0 0 0.00 0.00% 03 0 18 18.00 0.00% 04 0 0 0.00 0.00% 05 0 7 7.00 0.00% 06 0 1 1.00 0.00% 07 0 0 0.00 0.00% 08 0 1 1.00 0.00% 09 0 0 0.00 0.00% 10 0 0 0.00 0.00% 11 0 10 10.00 0.00% 12 0 0 0.00 0.00% 13 0 0 0.00 0.00% 14 0 0 0.00 0.00% 15 0 0 0.00 0.00% 16 0 0 0.00 0.00% 17 0 0 0.00 0.00% 18 0 0 0.00 0.00% 19 0 0 0.00 0.00% 20 0 0 0.00 0.00% 21 0 0 0.00 0.00% 22 0 0 0.00 0.00% 23 0 5 5.00 0.00% May 04 00 0 3 3.00 0.00% 01 0 0 0.00 0.00% 02 0 0 0.00 0.00% 03 0 1 1.00 0.00% 04 0 4 4.00 0.00% 05 0 4 4.00 0.00% 06 0 3 3.00 0.00% 07 0 0 0.00 0.00% 08 0 1 1.00 0.00% 09 0 0 0.00 0.00% 10 0 0 0.00 0.00% 11 0 2 2.00 0.00% 12 0 1 1.00 0.00% 13 0 12 12.00 0.00% 14 0 31 31.00 0.00% 15 0 0 0.00 0.00% 16 0 0 0.00 0.00% 17 0 0 0.00 0.00% 18 0 0 0.00 0.00% 19 0 3 3.00 0.00% 20 0 0 0.00 0.00% 21 0 0 0.00 0.00% 22 0 0 0.00 0.00% 23 0 0 0.00 0.00% May 05 00 0 6 6.00 0.00% 01 0 5 5.00 0.00% 02 0 0 0.00 0.00% 03 0 0 0.00 0.00% 04 0 3 3.00 0.00% 05 0 3 3.00 0.00% 06 0 7 7.00 0.00% 07 0 5 5.00 0.00% 08 0 0 0.00 0.00% 09 0 0 0.00 0.00% 10 0 2 2.00 0.00% 11 0 0 0.00 0.00% 12 0 0 0.00 0.00% 13 0 0 0.00 0.00% 14 0 0 0.00 0.00% 15 0 0 0.00 0.00% 16 0 0 0.00 0.00% 17 0 0 0.00 0.00% 18 0 0 0.00 0.00% 19 0 0 0.00 0.00% 20 0 0 0.00 0.00% 21 0 0 0.00 0.00% 22 0 0 0.00 0.00% 23 0 0 0.00 0.00% May 06 00 0 1 1.00 0.00% 01 0 1 1.00 0.00% 02 0 0 0.00 0.00% 03 0 0 0.00 0.00% 04 0 0 0.00 0.00% 05 0 2 2.00 0.00% 06 0 0 0.00 0.00% 07 0 5 5.00 0.00% 08 0 0 0.00 0.00% 09 0 4 4.00 0.00% 10 0 0 0.00 0.00% 11 0 1 1.00 0.00% 12 0 13 13.00 0.00% 13 0 0 0.00 0.00% 14 0 0 0.00 0.00% 15 0 2 2.00 0.00% 16 0 0 0.00 0.00% 17 0 0 0.00 0.00% 18 0 0 0.00 0.00% 19 0 0 0.00 0.00% 20 0 1 1.00 0.00% 21 0 2 2.00 0.00% 22 0 0 0.00 0.00% 23 0 0 0.00 0.00% May 07 00 0 0 0.00 0.00% 01 0 1 1.00 0.00% 02 0 0 0.00 0.00% 03 0 1 1.00 0.00% 04 0 0 0.00 0.00% 05 0 2 2.00 0.00% 06 0 3 3.00 0.00% 07 0 4 4.00 0.00% 08 0 0 0.00 0.00% 09 0 2 2.00 0.00% 10 0 2 2.00 0.00% 11 0 0 0.00 0.00% 12 0 1 1.00 0.00% 13 0 0 0.00 0.00% 14 0 0 0.00 0.00% 15 0 2 2.00 0.00% 16 0 0 0.00 0.00% 17 0 0 0.00 0.00% 18 0 0 0.00 0.00% 19 0 0 0.00 0.00% 20 0 0 0.00 0.00% 21 0 1 1.00 0.00% 22 0 0 0.00 0.00% 23 0 0 0.00 0.00% May 08 00 0 0 0.00 0.00% 01 0 0 0.00 0.00% 02 0 2 2.00 0.00% 03 0 1 1.00 0.00% 04 0 0 0.00 0.00% 05 0 2 2.00 0.00% 06 0 0 0.00 0.00% 07 0 2 2.00 0.00% 08 0 14 14.00 0.00% 09 0 0 0.00 0.00% 10 0 0 0.00 0.00% 11 0 3 3.00 0.00% 12 0 1 1.00 0.00% 13 0 2 2.00 0.00% 14 0 3 3.00 0.00% 15 0 9 9.00 0.00% 16 0 0 0.00 0.00% 17 0 0 0.00 0.00% 18 0 0 0.00 0.00% 19 0 0 0.00 0.00% 20 0 0 0.00 0.00% 21 0 4 4.00 0.00% 22 0 9 9.00 0.00% 23 0 4 4.00 0.00% May 09 00 0 0 0.00 0.00% 01 0 1 1.00 0.00% 02 0 0 0.00 0.00% 03 0 0 0.00 0.00% 04 0 0 0.00 0.00% 05 0 5 5.00 0.00% 06 0 0 0.00 0.00% 07 0 3 3.00 0.00% 08 0 1 1.00 0.00% 09 0 0 0.00 0.00% 10 0 0 0.00 0.00% 11 0 1 1.00 0.00% 12 0 1 1.00 0.00% 13 0 0 0.00 0.00% 14 0 3 3.00 0.00% 15 0 0 0.00 0.00% 16 0 0 0.00 0.00% 17 0 1 1.00 0.00% 18 0 0 0.00 0.00% 19 0 0 0.00 0.00% 20 0 0 0.00 0.00% 21 0 0 0.00 0.00% 22 0 1 1.00 0.00% 23 0 2 2.00 0.00% Day Hour Count Average / Second May 03 00 79 0.02/s 01 83 0.02/s 02 80 0.02/s 03 139 0.04/s 04 79 0.02/s 05 111 0.03/s 06 81 0.02/s 07 75 0.02/s 08 73 0.02/s 09 76 0.02/s 10 78 0.02/s 11 140 0.04/s 12 78 0.02/s 13 82 0.02/s 14 81 0.02/s 15 77 0.02/s 16 77 0.02/s 17 76 0.02/s 18 79 0.02/s 19 78 0.02/s 20 76 0.02/s 21 69 0.02/s 22 79 0.02/s 23 82 0.02/s May 04 00 80 0.02/s 01 77 0.02/s 02 81 0.02/s 03 78 0.02/s 04 107 0.03/s 05 113 0.03/s 06 74 0.02/s 07 78 0.02/s 08 77 0.02/s 09 70 0.02/s 10 79 0.02/s 11 95 0.03/s 12 81 0.02/s 13 90 0.03/s 14 93 0.03/s 15 80 0.02/s 16 83 0.02/s 17 77 0.02/s 18 80 0.02/s 19 82 0.02/s 20 77 0.02/s 21 75 0.02/s 22 78 0.02/s 23 80 0.02/s May 05 00 84 0.02/s 01 80 0.02/s 02 79 0.02/s 03 78 0.02/s 04 80 0.02/s 05 89 0.02/s 06 109 0.03/s 07 145 0.04/s 08 72 0.02/s 09 75 0.02/s 10 79 0.02/s 11 78 0.02/s 12 80 0.02/s 13 83 0.02/s 14 79 0.02/s 15 75 0.02/s 16 78 0.02/s 17 80 0.02/s 18 82 0.02/s 19 77 0.02/s 20 76 0.02/s 21 73 0.02/s 22 79 0.02/s 23 84 0.02/s May 06 00 79 0.02/s 01 100 0.03/s 02 107 0.03/s 03 75 0.02/s 04 72 0.02/s 05 95 0.03/s 06 75 0.02/s 07 74 0.02/s 08 77 0.02/s 09 80 0.02/s 10 80 0.02/s 11 74 0.02/s 12 111 0.03/s 13 81 0.02/s 14 83 0.02/s 15 79 0.02/s 16 79 0.02/s 17 79 0.02/s 18 81 0.02/s 19 81 0.02/s 20 77 0.02/s 21 80 0.02/s 22 85 0.02/s 23 80 0.02/s May 07 00 82 0.02/s 01 74 0.02/s 02 80 0.02/s 03 88 0.02/s 04 86 0.02/s 05 94 0.03/s 06 81 0.02/s 07 132 0.04/s 08 78 0.02/s 09 82 0.02/s 10 84 0.02/s 11 79 0.02/s 12 79 0.02/s 13 74 0.02/s 14 79 0.02/s 15 77 0.02/s 16 77 0.02/s 17 74 0.02/s 18 80 0.02/s 19 79 0.02/s 20 77 0.02/s 21 77 0.02/s 22 77 0.02/s 23 78 0.02/s May 08 00 80 0.02/s 01 85 0.02/s 02 81 0.02/s 03 82 0.02/s 04 84 0.02/s 05 91 0.03/s 06 79 0.02/s 07 87 0.02/s 08 91 0.03/s 09 78 0.02/s 10 82 0.02/s 11 82 0.02/s 12 95 0.03/s 13 82 0.02/s 14 87 0.02/s 15 88 0.02/s 16 69 0.02/s 17 75 0.02/s 18 80 0.02/s 19 77 0.02/s 20 78 0.02/s 21 78 0.02/s 22 86 0.02/s 23 79 0.02/s May 09 00 79 0.02/s 01 77 0.02/s 02 85 0.02/s 03 79 0.02/s 04 92 0.03/s 05 96 0.03/s 06 80 0.02/s 07 92 0.03/s 08 82 0.02/s 09 80 0.02/s 10 79 0.02/s 11 83 0.02/s 12 76 0.02/s 13 75 0.02/s 14 79 0.02/s 15 73 0.02/s 16 78 0.02/s 17 80 0.02/s 18 84 0.02/s 19 75 0.02/s 20 76 0.02/s 21 74 0.02/s 22 80 0.02/s 23 77 0.02/s Day Hour Count Average Duration Average idle time May 03 00 79 31m12s 31m5s 01 83 29m1s 29m 02 80 30m36s 30m36s 03 139 18m29s 18m17s 04 79 29m59s 29m59s 05 111 23m23s 23m22s 06 81 29m33s 29m33s 07 75 31m57s 31m57s 08 73 32m1s 32m1s 09 76 32m7s 32m7s 10 78 28m39s 28m39s 11 140 18m6s 18m5s 12 78 30m57s 30m57s 13 82 29m8s 29m8s 14 81 29m56s 29m56s 15 77 31m17s 31m17s 16 77 31m22s 31m22s 17 76 31m5s 31m5s 18 79 31m19s 31m19s 19 78 30m56s 30m56s 20 76 30m53s 30m53s 21 69 31m23s 31m23s 22 79 31m7s 31m7s 23 82 29m 28m56s May 04 00 80 29m53s 29m45s 01 77 31m7s 31m7s 02 81 30m2s 30m2s 03 78 31m36s 31m36s 04 104 24m7s 24m5s 05 116 20m41s 20m41s 06 74 30m24s 30m21s 07 78 32m5s 32m5s 08 77 31m33s 31m33s 09 70 32m19s 32m19s 10 79 30m56s 30m54s 11 95 4d13h6m34s 4d13h6m34s 12 81 29m30s 29m30s 13 90 37m51s 37m51s 14 93 31m22s 31m18s 15 80 31m20s 31m20s 16 80 29m27s 29m27s 17 77 32m2s 32m2s 18 80 30m11s 30m8s 19 82 29m27s 29m27s 20 77 30m33s 30m33s 21 75 30m43s 30m43s 22 78 30m32s 30m32s 23 80 30m7s 30m7s May 05 00 84 29m56s 29m49s 01 80 29m33s 29m32s 02 79 30m46s 30m46s 03 78 30m49s 30m49s 04 80 29m45s 29m42s 05 89 27m22s 27m22s 06 108 22m39s 22m36s 07 146 16m39s 16m38s 08 72 30m33s 30m33s 09 75 32m34s 32m34s 10 79 30m42s 30m39s 11 78 30m46s 30m46s 12 80 30m19s 30m19s 13 83 28m47s 28m47s 14 79 30m42s 30m40s 15 77 3h43s 3h43s 16 81 1h23m43s 1h23m43s 17 81 1h43m 1h43m 18 82 29m51s 29m48s 19 77 30m51s 30m51s 20 76 31m4s 31m4s 21 73 30m57s 30m57s 22 79 30m38s 30m38s 23 84 29m9s 29m9s May 06 00 79 30m39s 30m32s 01 100 24m46s 24m46s 02 107 22m37s 22m37s 03 75 32m18s 32m18s 04 72 33m8s 33m8s 05 95 26m35s 26m35s 06 75 29m54s 29m51s 07 74 31m5s 31m4s 08 77 31m14s 31m14s 09 80 30m29s 30m29s 10 77 31m10s 31m8s 11 73 31m40s 31m40s 12 108 22m22s 22m17s 13 85 35m5s 35m5s 14 85 31m17s 31m14s 15 80 32m43s 32m43s 16 79 30m12s 30m12s 17 79 31m25s 31m25s 18 81 30m12s 30m9s 19 79 30m53s 30m53s 20 77 30m51s 30m51s 21 80 27m28s 27m28s 22 85 29m2s 29m2s 23 80 30m30s 30m30s May 07 00 82 30m31s 30m22s 01 74 30m57s 30m57s 02 80 30m17s 30m17s 03 88 28m 28m 04 86 28m7s 28m7s 05 94 26m13s 26m12s 06 81 27m7s 27m3s 07 132 17m38s 17m38s 08 78 31m48s 31m48s 09 82 29m56s 29m55s 10 84 29m25s 29m22s 11 79 30m14s 30m14s 12 79 29m36s 29m36s 13 74 32m24s 32m24s 14 79 30m36s 30m34s 15 77 31m14s 31m13s 16 77 32m9s 32m9s 17 74 31m8s 31m8s 18 80 30m20s 30m18s 19 79 30m31s 30m31s 20 77 30m40s 30m40s 21 77 29m49s 29m49s 22 77 30m33s 30m33s 23 78 31m10s 31m10s May 08 00 80 30m35s 30m28s 01 85 28m41s 28m41s 02 81 30m5s 30m5s 03 82 30m5s 30m5s 04 84 28m39s 28m39s 05 91 24m56s 24m56s 06 79 29m34s 29m32s 07 87 28m19s 28m18s 08 91 26m59s 26m38s 09 78 30m46s 30m46s 10 82 30m9s 30m6s 11 82 28m44s 28m33s 12 95 28m2s 28m2s 13 82 28m28s 28m27s 14 86 27m10s 27m3s 15 89 27m44s 27m33s 16 69 30m27s 30m27s 17 75 31m21s 31m21s 18 80 30m25s 30m23s 19 77 31m9s 31m9s 20 78 30m41s 30m41s 21 78 29m41s 29m40s 22 86 28m59s 28m58s 23 79 30m39s 30m39s May 09 00 79 30m20s 30m13s 01 77 31m39s 31m38s 02 85 29m5s 29m5s 03 79 30m21s 30m21s 04 92 26m34s 26m34s 05 96 25m10s 25m10s 06 80 29m59s 29m59s 07 94 1h42m39s 1h42m39s 08 82 29m54s 29m54s 09 80 30m56s 30m56s 10 79 29m40s 29m40s 11 80 30m52s 30m52s 12 77 31m14s 31m14s 13 75 30m59s 30m59s 14 81 33m6s 33m6s 15 73 31m 31m 16 78 30m44s 30m44s 17 80 30m10s 30m10s 18 79 30m48s 30m11s 19 76 31m44s 31m6s 20 76 31m9s 31m9s 21 74 30m12s 30m12s 22 79 30m46s 30m46s 23 78 30m48s 30m26s -
Connections
Established Connections
Key values
- 9 connections Connection Peak
- 2026-05-03 03:46:26 Date
Connections per database
Key values
- ctdprd51 Main Database
- 13,866 connections Total
Connections per user
Key values
- pubeu Main User
- 13,866 connections Total
-
Sessions
Simultaneous sessions
Key values
- 60 sessions Session Peak
- 2026-05-06 01:24:58 Date
Histogram of session times
Key values
- 12,562 1800000-3600000ms duration
Sessions per database
Key values
- ctdprd51 Main Database
- 13,865 sessions Total
Sessions per user
Key values
- pubeu Main User
- 13,865 sessions Total
Sessions per host
Key values
- 10.12.5.53 Main Host
- 13,865 sessions Total
Host Count Total Duration Average Duration 10.12.5.122 42 431d6h26m37s 10d6h26m20s 10.12.5.126 4 11m29s 2m52s 10.12.5.45 2,685 55d23h48m 30m1s 10.12.5.46 2,635 55d23h20m13s 30m35s 10.12.5.53 3,224 56d6h21m31s 25m7s 10.12.5.54 2,622 56d8m59s 30m45s 10.12.5.55 2,590 56d1h2m28s 31m9s 10.12.5.56 1 6m44s 6m44s 192.168.201.14 11 20d8h9m59s 1d20h22m43s 192.168.201.6 8 16h4m51s 2h36s ::1 43 2h54m56s 4m4s -
Checkpoints / Restartpoints
Checkpoints Buffers
Key values
- 103,360 buffers Checkpoint Peak
- 2026-05-07 12:47:38 Date
- 1619.904 seconds Highest write time
- 0.026 seconds Sync time
Checkpoints Wal files
Key values
- 31 files Wal files usage Peak
- 2026-05-09 22:17:45 Date
Checkpoints distance
Key values
- 2,190.29 Mo Distance Peak
- 2026-05-07 12:47:38 Date
Checkpoints Activity
↑ Back to the top of the Checkpoint Activity tableDay Hour Written buffers Write time Sync time Total time May 03 00 5,373 538.152s 0.002s 538.211s 01 388 38.938s 0.002s 38.948s 02 71 7.269s 0.002s 7.279s 03 154 15.615s 0.002s 15.625s 04 161 16.318s 0.002s 16.328s 05 252 25.461s 0.002s 25.521s 06 5,999 600.975s 0.002s 601.031s 07 475 47.795s 0.002s 47.845s 08 319 32.148s 0.002s 32.157s 09 230 23.216s 0.002s 23.224s 10 64 6.487s 0.002s 6.497s 11 152 15.416s 0.002s 15.425s 12 26 2.773s 0.002s 2.782s 13 21 2.192s 0.001s 2.196s 14 13,097 1,311.787s 0.003s 1,311.825s 15 44 4.578s 0.002s 4.587s 16 140 14.202s 0.002s 14.211s 17 30 3.178s 0.002s 3.187s 18 23 2.494s 0.002s 2.503s 19 27 2.874s 0.002s 2.883s 20 513 51.541s 0.002s 51.55s 21 33 3.483s 0.002s 3.492s 22 49 5.08s 0.002s 5.09s 23 51 5.289s 0.002s 5.298s May 04 00 377 37.977s 0.002s 37.989s 01 25 2.682s 0.002s 2.691s 02 52 5.292s 0.001s 5.296s 03 61,973 1,639.478s 0.002s 1,639.627s 04 103 10.41s 0.026s 10.487s 05 87,630 3,251.444s 0.003s 3,251.644s 06 3,720 372.69s 0.002s 372.786s 07 965 96.854s 0.002s 96.865s 08 366 36.855s 0.002s 36.865s 09 493 49.565s 0.002s 49.612s 10 294 29.638s 0.002s 29.646s 11 138 14.007s 0.002s 14.015s 12 501 50.356s 0.002s 50.365s 13 3,757 376.299s 0.002s 376.315s 14 253 25.523s 0.003s 25.533s 15 224 22.53s 0.002s 22.538s 16 182 18.41s 0.002s 18.42s 17 211 21.312s 0.002s 21.362s 18 322 32.427s 0.002s 32.437s 19 47 4.882s 0.002s 4.892s 20 50 5.188s 0.002s 5.229s 21 29 3.074s 0.002s 3.083s 22 64,762 1,622.004s 0.002s 1,622.139s 23 541 54.351s 0.002s 54.36s May 05 00 399 40.143s 0.003s 40.196s 01 114 11.488s 0.002s 11.496s 02 38 3.985s 0.002s 3.995s 03 128 12.992s 0.002s 13.001s 04 132 13.399s 0.002s 13.409s 05 219 22.141s 0.002s 22.15s 06 96 9.705s 0.001s 9.71s 07 44,355 1,619.385s 0.001s 1,619.571s 08 53,495 1,661.191s 0.004s 1,661.258s 09 960 96.352s 0.002s 96.361s 10 1,065 106.878s 0.002s 106.892s 11 339 34.05s 0.002s 34.06s 12 158 15.997s 0.002s 16.006s 13 77 7.881s 0.002s 7.89s 14 80 8.189s 0.002s 8.198s 15 211 21.305s 0.002s 21.332s 16 2,297 229.927s 0.002s 229.979s 17 35 3.704s 0.002s 3.712s 18 97 9.8s 0.001s 9.804s 19 24 2.565s 0.002s 2.575s 20 17 1.879s 0.002s 1.888s 21 234 23.613s 0.002s 23.623s 22 61 6.285s 0.002s 6.294s 23 85 8.687s 0.002s 8.696s May 06 00 1,882 188.661s 0.003s 188.672s 01 16 1.689s 0.001s 1.693s 02 7,053 705.807s 0.004s 705.87s 03 335 33.441s 0.001s 33.449s 04 26,020 2,182.947s 0.003s 2,183.126s 05 35,690 1,637.798s 0.002s 1,637.808s 06 64,118 1,667.283s 0.003s 1,667.411s 07 280 28.228s 0.003s 28.237s 08 25,689 1,619.78s 0.001s 1,619.894s 09 10,363 1,037.698s 0.003s 1,037.71s 10 405 40.631s 0.002s 40.64s 11 150 15.193s 0.002s 15.202s 12 258 26.03s 0.002s 26.089s 13 57 5.884s 0.002s 5.893s 14 111 11.28s 0.002s 11.29s 15 235 23.73s 0.002s 23.738s 16 426 42.873s 0.002s 42.928s 17 115 11.608s 0.001s 11.613s 18 16 1.691s 0.001s 1.696s 19 0 0s 0s 0s 20 17 1.866s 0.002s 1.875s 21 55 5.693s 0.002s 5.702s 22 80 8.182s 0.002s 8.19s 23 72 7.279s 0.002s 7.287s May 07 00 1,735 173.926s 0.003s 173.986s 01 647 64.969s 0.002s 64.978s 02 6,211 622.051s 0.002s 622.156s 03 219 22.027s 0.001s 22.032s 04 43,337 1,677.402s 0.003s 1,677.517s 05 1,340 134.372s 0.002s 134.382s 06 2,381 238.619s 0.002s 238.673s 07 513 51.515s 0.002s 51.533s 08 44,339 1,623.578s 0.002s 1,623.708s 09 96 9.79s 0.002s 9.799s 10 1,538 154.124s 0.001s 154.173s 11 55,739 2,055.326s 0.003s 2,055.515s 12 103,536 1,637.587s 0.003s 1,637.736s 13 3,063 306.948s 0.002s 307.005s 14 151 15.307s 0.002s 15.317s 15 209 21.009s 0.002s 21.019s 16 164 16.597s 0.003s 16.606s 17 16 1.764s 0.002s 1.772s 18 29 3.071s 0.002s 3.081s 19 19 2.07s 0.002s 2.079s 20 35 3.668s 0.002s 3.677s 21 29 2.986s 0.001s 2.991s 22 96,729 1,628.404s 0.003s 1,628.547s 23 94 9.693s 0.002s 9.701s May 08 00 354 35.708s 0.003s 35.719s 01 122 12.395s 0.002s 12.404s 02 148 15.002s 0.002s 15.011s 03 5,563 557.148s 0.002s 557.204s 04 117 11.931s 0.002s 11.94s 05 216 21.818s 0.002s 21.827s 06 364 36.635s 0.002s 36.643s 07 667 66.997s 0.002s 67.006s 08 493 49.494s 0.002s 49.502s 09 113 11.49s 0.002s 11.499s 10 87 8.928s 0.002s 8.937s 11 4,368 437.437s 0.002s 437.493s 12 1,646 165.029s 0.002s 165.041s 13 4,165 417.201s 0.002s 417.25s 14 171 17.306s 0.002s 17.315s 15 383 38.453s 0.002s 38.462s 16 5,453 545.921s 0.002s 545.979s 17 23 2.475s 0.002s 2.483s 18 32 3.36s 0.002s 3.369s 19 22 2.372s 0.002s 2.38s 20 548 55.039s 0.002s 55.047s 21 56 5.799s 0.002s 5.808s 22 134 13.619s 0.002s 13.628s 23 3,930 393.628s 0.002s 393.715s May 09 00 943 94.632s 0.003s 94.644s 01 75 7.686s 0.002s 7.695s 02 1,379 138.259s 0.002s 138.309s 03 135 13.68s 0.002s 13.689s 04 182 18.409s 0.002s 18.419s 05 217 21.929s 0.002s 21.938s 06 126 12.681s 0.002s 12.689s 07 331 33.325s 0.004s 33.336s 08 2,178 218.34s 0.002s 218.391s 09 467 46.958s 0.002s 46.967s 10 120 12.183s 0.002s 12.193s 11 65 6.661s 0.002s 6.669s 12 143 14.476s 0.002s 14.486s 13 52 5.393s 0.002s 5.403s 14 18 1.98s 0.002s 1.99s 15 9 1s 0.001s 1.004s 16 10 1.081s 0.001s 1.085s 17 50 5.183s 0.002s 5.193s 18 1,010 101.221s 0.001s 101.225s 19 0 0s 0s 0s 20 8,443 845.651s 0.002s 845.704s 21 14 1.479s 0.001s 1.484s 22 47,153 1,630.02s 0.003s 1,630.13s 23 35 3.709s 0.002s 3.719s Day Hour Added Removed Recycled Synced files Longest sync Average sync May 03 00 0 3 0 78 0.001s 0.002s 01 0 0 0 33 0.001s 0.002s 02 0 0 0 26 0.001s 0.002s 03 0 0 0 33 0.001s 0.002s 04 0 0 0 31 0.001s 0.002s 05 0 1 0 28 0.001s 0.002s 06 0 3 0 133 0.001s 0.002s 07 0 1 0 121 0.001s 0.002s 08 0 0 0 126 0.001s 0.002s 09 0 0 0 75 0.001s 0.002s 10 0 0 0 27 0.001s 0.002s 11 0 0 0 34 0.001s 0.002s 12 0 0 0 17 0.001s 0.002s 13 0 0 0 9 0.001s 0.001s 14 0 6 0 51 0.001s 0.003s 15 0 0 0 17 0.001s 0.002s 16 0 0 0 26 0.001s 0.002s 17 0 0 0 14 0.001s 0.002s 18 0 0 0 15 0.001s 0.002s 19 0 0 0 14 0.001s 0.002s 20 0 0 0 26 0.001s 0.002s 21 0 0 0 20 0.001s 0.002s 22 0 0 0 17 0.001s 0.002s 23 0 0 0 20 0.001s 0.002s May 04 00 0 0 0 71 0.001s 0.002s 01 0 0 0 18 0.001s 0.002s 02 0 0 0 11 0.001s 0.001s 03 0 37 0 44 0.001s 0.002s 04 0 3 0 23 0.015s 0.002s 05 0 57 0 80 0.001s 0.003s 06 0 2 0 124 0.001s 0.002s 07 0 0 0 128 0.001s 0.002s 08 0 0 0 116 0.001s 0.002s 09 0 1 0 116 0.001s 0.002s 10 0 0 0 113 0.001s 0.002s 11 0 0 0 60 0.001s 0.002s 12 0 0 0 28 0.001s 0.002s 13 0 2 0 36 0.001s 0.002s 14 0 0 0 61 0.001s 0.002s 15 0 0 0 118 0.001s 0.002s 16 0 0 0 68 0.001s 0.002s 17 0 1 0 66 0.001s 0.002s 18 0 0 0 42 0.001s 0.002s 19 0 0 0 19 0.001s 0.002s 20 0 0 0 19 0.001s 0.002s 21 0 0 0 16 0.001s 0.002s 22 0 30 0 43 0.001s 0.002s 23 0 0 0 41 0.001s 0.002s May 05 00 0 1 0 72 0.001s 0.002s 01 0 0 0 27 0.001s 0.002s 02 0 0 0 20 0.001s 0.002s 03 0 0 0 26 0.001s 0.002s 04 0 0 0 26 0.001s 0.002s 05 0 0 0 38 0.001s 0.002s 06 0 0 0 19 0.001s 0.001s 07 0 50 0 28 0.001s 0.001s 08 0 4 0 154 0.001s 0.003s 09 0 0 0 136 0.001s 0.002s 10 0 1 0 154 0.001s 0.002s 11 0 0 0 125 0.001s 0.002s 12 0 0 0 32 0.001s 0.002s 13 0 0 0 18 0.001s 0.002s 14 0 0 0 31 0.001s 0.002s 15 0 0 0 67 0.001s 0.002s 16 0 2 0 96 0.001s 0.002s 17 0 0 0 14 0.001s 0.002s 18 0 0 0 12 0.001s 0.001s 19 0 0 0 14 0.001s 0.002s 20 0 0 0 14 0.001s 0.002s 21 0 0 0 28 0.001s 0.002s 22 0 0 0 19 0.001s 0.002s 23 0 0 0 20 0.001s 0.002s May 06 00 0 0 0 83 0.001s 0.002s 01 0 0 0 8 0.001s 0.001s 02 0 4 0 79 0.001s 0.003s 03 0 1 0 20 0.001s 0.001s 04 0 34 0 59 0.001s 0.002s 05 0 0 0 49 0.001s 0.002s 06 0 28 0 146 0.001s 0.003s 07 0 0 0 74 0.001s 0.002s 08 0 24 0 31 0.001s 0.001s 09 0 0 0 45 0.001s 0.003s 10 0 0 0 22 0.001s 0.002s 11 0 0 0 21 0.001s 0.002s 12 0 1 0 49 0.001s 0.002s 13 0 0 0 21 0.001s 0.002s 14 0 0 0 18 0.001s 0.002s 15 0 0 0 109 0.001s 0.002s 16 0 1 0 125 0.001s 0.002s 17 0 0 0 51 0.001s 0.001s 18 0 0 0 10 0.001s 0.001s 19 0 0 0 0 0s 0s 20 0 0 0 15 0.001s 0.002s 21 0 0 0 21 0.001s 0.002s 22 0 0 0 20 0.001s 0.002s 23 0 0 0 23 0.001s 0.002s May 07 00 0 1 0 70 0.001s 0.002s 01 0 0 0 40 0.001s 0.002s 02 0 4 0 49 0.001s 0.002s 03 0 0 0 16 0.001s 0.001s 04 0 21 0 71 0.001s 0.003s 05 0 0 0 39 0.001s 0.002s 06 0 1 0 137 0.001s 0.002s 07 0 1 0 137 0.001s 0.002s 08 0 29 0 87 0.001s 0.002s 09 0 0 0 21 0.001s 0.002s 10 0 1 0 34 0.001s 0.001s 11 0 38 0 96 0.001s 0.003s 12 0 36 0 164 0.001s 0.002s 13 0 2 0 126 0.001s 0.002s 14 0 0 0 68 0.001s 0.002s 15 0 0 0 64 0.001s 0.002s 16 0 0 0 68 0.001s 0.002s 17 0 0 0 14 0.001s 0.002s 18 0 0 0 17 0.001s 0.002s 19 0 0 0 13 0.001s 0.002s 20 0 0 0 18 0.001s 0.002s 21 0 0 0 9 0.001s 0.001s 22 0 27 9 53 0.001s 0.003s 23 0 0 0 24 0.001s 0.002s May 08 00 0 0 0 68 0.001s 0.002s 01 0 0 0 28 0.001s 0.002s 02 0 0 0 31 0.001s 0.002s 03 0 0 4 50 0.001s 0.002s 04 0 0 0 29 0.001s 0.002s 05 0 0 0 36 0.001s 0.002s 06 0 0 0 121 0.001s 0.002s 07 0 0 0 152 0.001s 0.002s 08 0 0 0 129 0.001s 0.002s 09 0 0 0 26 0.001s 0.002s 10 0 0 0 23 0.001s 0.002s 11 0 0 3 38 0.001s 0.002s 12 0 1 0 42 0.001s 0.002s 13 0 0 2 41 0.001s 0.002s 14 0 0 0 24 0.001s 0.002s 15 0 0 0 29 0.001s 0.002s 16 0 0 4 38 0.001s 0.002s 17 0 0 0 14 0.001s 0.002s 18 0 0 0 16 0.001s 0.002s 19 0 0 0 12 0.001s 0.002s 20 0 0 0 27 0.001s 0.002s 21 0 0 0 17 0.001s 0.002s 22 0 0 0 19 0.001s 0.002s 23 0 0 2 61 0.001s 0.002s May 09 00 0 0 0 76 0.001s 0.002s 01 0 0 0 21 0.001s 0.002s 02 0 0 1 38 0.001s 0.002s 03 0 0 0 29 0.001s 0.002s 04 0 0 0 38 0.001s 0.002s 05 0 0 0 36 0.001s 0.002s 06 0 0 0 28 0.001s 0.002s 07 0 0 0 28 0.001s 0.002s 08 0 0 1 39 0.001s 0.002s 09 0 0 0 33 0.001s 0.002s 10 0 0 0 21 0.001s 0.002s 11 0 0 0 22 0.001s 0.002s 12 0 0 0 27 0.001s 0.002s 13 0 0 0 16 0.001s 0.002s 14 0 0 0 13 0.001s 0.002s 15 0 0 0 6 0.001s 0.001s 16 0 0 0 7 0.001s 0.001s 17 0 0 0 19 0.001s 0.002s 18 0 0 0 27 0.001s 0.001s 19 0 0 0 0 0s 0s 20 0 0 1 25 0.001s 0.002s 21 0 0 0 6 0.001s 0.001s 22 0 0 31 46 0.001s 0.003s 23 0 0 0 18 0.001s 0.002s Day Hour Count Avg time (sec) May 03 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s May 04 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s May 05 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s May 06 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s May 07 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s May 08 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s May 09 00 0 0s 01 0 0s 02 0 0s 03 0 0s 04 0 0s 05 0 0s 06 0 0s 07 0 0s 08 0 0s 09 0 0s 10 0 0s 11 0 0s 12 0 0s 13 0 0s 14 0 0s 15 0 0s 16 0 0s 17 0 0s 18 0 0s 19 0 0s 20 0 0s 21 0 0s 22 0 0s 23 0 0s Day Hour Mean distance Mean estimate May 03 00 29,339.50 kB 358,749.50 kB 01 1,191.00 kB 290,711.00 kB 02 58.50 kB 235,590.50 kB 03 418.00 kB 190,885.50 kB 04 221.00 kB 154,666.00 kB 05 413.50 kB 125,341.00 kB 06 31,903.00 kB 107,556.50 kB 07 1,147.00 kB 87,353.50 kB 08 987.50 kB 70,956.00 kB 09 677.50 kB 57,623.50 kB 10 126.50 kB 46,713.50 kB 11 433.00 kB 37,890.00 kB 12 56.00 kB 30,733.50 kB 13 87.00 kB 26,216.00 kB 14 32,005.00 kB 52,422.00 kB 15 50.00 kB 42,559.00 kB 16 260.00 kB 34,520.00 kB 17 72.50 kB 27,976.00 kB 18 30.50 kB 22,669.00 kB 19 34.00 kB 18,367.00 kB 20 1,726.00 kB 15,205.50 kB 21 64.00 kB 12,327.50 kB 22 66.00 kB 9,997.50 kB 23 86.50 kB 8,113.00 kB May 04 00 1,407.00 kB 6,842.50 kB 01 29.00 kB 5,548.00 kB 02 258.00 kB 4,757.00 kB 03 300,747.50 kB 571,145.00 kB 04 386.00 kB 487,029.00 kB 05 329,347.33 kB 659,791.67 kB 06 14,218.50 kB 515,575.50 kB 07 3,259.00 kB 419,022.50 kB 08 903.50 kB 339,586.50 kB 09 808.50 kB 275,248.50 kB 10 707.00 kB 223,083.50 kB 11 391.50 kB 180,800.50 kB 12 1,437.50 kB 146,719.50 kB 13 18,917.50 kB 120,758.50 kB 14 708.00 kB 99,571.50 kB 15 632.00 kB 80,814.50 kB 16 540.00 kB 65,534.00 kB 17 646.50 kB 53,250.50 kB 18 831.50 kB 43,275.00 kB 19 99.00 kB 35,084.00 kB 20 63.50 kB 28,432.00 kB 21 54.00 kB 23,039.50 kB 22 250,834.00 kB 476,482.00 kB 23 1,430.00 kB 386,121.50 kB May 05 00 1,533.50 kB 313,139.50 kB 01 228.00 kB 253,687.00 kB 02 70.50 kB 205,511.50 kB 03 184.00 kB 166,501.50 kB 04 215.00 kB 134,893.00 kB 05 620.50 kB 109,358.50 kB 06 110.00 kB 93,294.00 kB 07 497,312.00 kB 497,312.00 kB 08 130,557.00 kB 439,590.00 kB 09 2,898.50 kB 337,499.00 kB 10 3,100.00 kB 273,901.50 kB 11 789.00 kB 222,220.00 kB 12 299.50 kB 180,066.00 kB 13 122.00 kB 145,892.50 kB 14 119.00 kB 118,195.50 kB 15 483.00 kB 95,808.00 kB 16 12,355.50 kB 79,956.50 kB 17 68.50 kB 64,796.50 kB 18 156.00 kB 55,267.00 kB 19 38.00 kB 47,259.50 kB 20 37.00 kB 38,285.50 kB 21 261.50 kB 31,045.00 kB 22 116.50 kB 25,182.00 kB 23 127.00 kB 20,423.00 kB May 06 00 4,221.50 kB 17,344.00 kB 01 25.00 kB 14,795.00 kB 02 23,469.67 kB 54,613.00 kB 03 3,206.00 kB 44,943.00 kB 04 143,502.50 kB 143,502.50 kB 05 141,420.00 kB 267,074.50 kB 06 151,928.33 kB 409,446.33 kB 07 880.00 kB 314,179.00 kB 08 278,287.00 kB 295,727.00 kB 09 38,041.67 kB 250,700.00 kB 10 871.00 kB 192,372.50 kB 11 224.00 kB 155,891.00 kB 12 7,050.50 kB 126,984.50 kB 13 124.00 kB 103,509.50 kB 14 90.50 kB 83,861.50 kB 15 722.50 kB 68,024.50 kB 16 1,309.00 kB 55,315.50 kB 17 895.00 kB 47,333.00 kB 18 42.00 kB 42,604.00 kB 19 0.00 kB 0.00 kB 20 30.50 kB 36,430.50 kB 21 96.00 kB 29,523.50 kB 22 109.50 kB 23,935.00 kB 23 124.50 kB 19,409.50 kB May 07 00 12,027.50 kB 22,818.00 kB 01 1,910.50 kB 18,678.50 kB 02 29,451.00 kB 31,443.50 kB 03 349.00 kB 40,928.00 kB 04 113,877.33 kB 305,849.00 kB 05 4,585.00 kB 235,503.50 kB 06 8,930.00 kB 192,439.00 kB 07 1,596.50 kB 156,169.00 kB 08 244,137.00 kB 463,731.50 kB 09 165.50 kB 375,652.00 kB 10 10,872.00 kB 321,388.00 kB 11 30,801.67 kB 267,084.00 kB 12 561,070.50 kB 1,065,393.00 kB 13 11,817.00 kB 865,228.00 kB 14 252.50 kB 700,881.00 kB 15 838.50 kB 567,820.50 kB 16 390.50 kB 460,078.50 kB 17 23.00 kB 372,669.00 kB 18 47.50 kB 301,871.00 kB 19 41.00 kB 244,521.50 kB 20 64.00 kB 198,073.00 kB 21 104.00 kB 168,898.00 kB 22 196,119.67 kB 531,264.00 kB 23 271.00 kB 407,343.00 kB May 08 00 1,371.50 kB 330,224.50 kB 01 306.00 kB 267,529.00 kB 02 238.00 kB 216,753.00 kB 03 29,257.00 kB 181,117.00 kB 04 226.00 kB 146,761.00 kB 05 556.50 kB 118,953.50 kB 06 918.00 kB 96,517.50 kB 07 2,049.50 kB 78,510.00 kB 08 908.50 kB 63,834.00 kB 09 254.50 kB 51,781.50 kB 10 209.50 kB 41,982.00 kB 11 22,105.50 kB 39,964.00 kB 12 5,316.50 kB 38,480.50 kB 13 20,205.50 kB 37,729.50 kB 14 510.50 kB 30,648.50 kB 15 803.50 kB 25,006.50 kB 16 27,866.50 kB 52,898.50 kB 17 49.50 kB 42,858.00 kB 18 44.00 kB 34,722.00 kB 19 45.50 kB 28,134.50 kB 20 1,585.50 kB 23,089.00 kB 21 99.50 kB 18,720.00 kB 22 126.00 kB 15,183.00 kB 23 13,681.00 kB 18,983.00 kB May 09 00 3,309.00 kB 16,197.50 kB 01 172.00 kB 13,298.00 kB 02 4,466.50 kB 11,232.50 kB 03 233.00 kB 9,526.00 kB 04 412.50 kB 7,792.50 kB 05 599.00 kB 6,407.50 kB 06 286.00 kB 5,276.50 kB 07 927.00 kB 4,373.50 kB 08 8,159.00 kB 8,902.00 kB 09 526.00 kB 11,818.50 kB 10 296.00 kB 9,629.50 kB 11 112.50 kB 7,838.00 kB 12 326.50 kB 6,391.50 kB 13 86.50 kB 5,213.50 kB 14 47.50 kB 4,234.00 kB 15 46.00 kB 3,617.00 kB 16 34.00 kB 3,258.00 kB 17 111.00 kB 2,801.50 kB 18 6,630.00 kB 6,630.00 kB 19 0.00 kB 0.00 kB 20 3,173.50 kB 6,123.50 kB 21 70.00 kB 5,653.00 kB 22 168,790.00 kB 456,969.33 kB 23 71.00 kB 350,368.50 kB -
Temporary Files
Size of temporary files
Key values
- 4.91 MiB Temp Files size Peak
- 2026-05-06 12:37:16 Date
Number of temporary files
Key values
- 4 per second Temp Files Peak
- 2026-05-06 12:37:16 Date
Temporary Files Activity
↑ Back to the top of the Temporary Files Activity tableDay Hour Count Total size Average size May 03 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 May 04 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 May 05 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 May 06 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 4 4.91 MiB 1.23 MiB 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 May 07 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 May 08 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 May 09 00 0 0 0 01 0 0 0 02 0 0 0 03 0 0 0 04 0 0 0 05 0 0 0 06 0 0 0 07 0 0 0 08 0 0 0 09 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 17 0 0 0 18 0 0 0 19 0 0 0 20 0 0 0 21 0 0 0 22 0 0 0 23 0 0 0 Queries generating the most temporary files (N)
Rank Count Total size Min size Max size Avg size Query 1 4 4.91 MiB 768.00 KiB 2.01 MiB 1.23 MiB vacuum full analyze edit.reference_contact;-
VACUUM FULL ANALYZE edit.reference_contact;
Date: 2026-05-06 12:37:16 Duration: 0ms
Queries generating the largest temporary files
Rank Size Query 1 2.01 MiB VACUUM FULL ANALYZE edit.reference_contact;[ Date: 2026-05-06 12:37:16 ]
2 1.11 MiB VACUUM FULL ANALYZE edit.reference_contact;[ Date: 2026-05-06 12:37:16 ]
3 1.04 MiB VACUUM FULL ANALYZE edit.reference_contact;[ Date: 2026-05-06 12:37:16 ]
4 768.00 KiB VACUUM FULL ANALYZE edit.reference_contact;[ Date: 2026-05-06 12:37:16 ]
-
Vacuums
Vacuums / Analyzes Distribution
Key values
- 10.98 sec Highest CPU-cost vacuum
Table pub2.term_set_enrichment_agent
Database ctdprd51 - 2026-05-07 10:27:18 Date
- 0 sec Highest CPU-cost analyze
Table
Database ctdprd51 - Date
Average Autovacuum Duration
Key values
- 10.98 sec Highest CPU-cost vacuum
Table pub2.term_set_enrichment_agent
Database ctdprd51 - 2026-05-07 10:27:18 Date
Analyzes per table
Key values
- pubc.log_query (129) Main table analyzed (database ctdprd51)
- 161 analyzes Total
Vacuums per table
Key values
- pubc.log_query (22) Main table vacuumed on database ctdprd51
- 41 vacuums Total
Index Buffer usage Skipped WAL usage Table Vacuums scans hits misses dirtied pins frozen records full page bytes ctdprd51.pubc.log_query 22 13 8,708 0 964 0 14 2,025 386 2,885,345 ctdprd51.pub2.term_set_enrichment_agent 8 0 547,105 0 159,193 0 0 273,133 16 16,243,054 ctdprd51.pub2.term_set_enrichment 7 0 12,783 0 4,178 0 0 6,026 12 431,847 ctdprd51.pg_toast.pg_toast_486223 3 0 104 0 4 0 0 4 1 8,820 ctdprd51.pg_catalog.pg_statistic 1 1 741 0 188 0 118 507 163 692,243 Total 41 14 569,441 96 164,527 0 132 281,695 578 20,261,309 Tuples removed per table
Key values
- pg_catalog.pg_statistic (571) Main table with removed tuples on database ctdprd51
- 694 tuples Total removed
Index Tuples Pages Table Vacuums scans removed remain not yet removable removed remain ctdprd51.pg_catalog.pg_statistic 1 1 571 3,435 0 0 410 ctdprd51.pubc.log_query 22 13 123 177,325 0 0 3,992 ctdprd51.pg_toast.pg_toast_486223 3 0 0 2 0 0 1 ctdprd51.pub2.term_set_enrichment_agent 8 0 0 116,891,637 0 0 1,328,323 ctdprd51.pub2.term_set_enrichment 7 0 0 1,665,160 0 0 27,596 Total 41 14 694 118,737,559 0 0 1,360,322 Pages removed per table
Key values
- unknown (0) Main table with removed pages on database unknown
- 0 pages Total removed
Pages removed per tables
NO DATASET
Table Number of vacuums Index scans Tuples removed Pages removed ctdprd51.pubc.log_query 22 13 123 0 ctdprd51.pg_toast.pg_toast_486223 3 0 0 0 ctdprd51.pub2.term_set_enrichment_agent 8 0 0 0 ctdprd51.pg_catalog.pg_statistic 1 1 571 0 ctdprd51.pub2.term_set_enrichment 7 0 0 0 Total 41 14 694 0 Autovacuum Activity
↑ Back to the top of the Autovacuum Activity tableDay Hour VACUUMs ANALYZEs May 03 00 1 0 01 0 1 02 0 0 03 0 3 04 0 1 05 1 2 06 0 2 07 0 0 08 0 0 09 0 1 10 0 0 11 0 2 12 0 0 13 0 2 14 0 0 15 0 0 16 0 1 17 0 0 18 0 0 19 0 0 20 0 0 21 0 0 22 0 0 23 0 0 May 04 00 2 0 01 0 0 02 3 4 03 0 3 04 2 7 05 0 5 06 0 0 07 0 1 08 1 1 09 0 0 10 0 0 11 0 0 12 0 0 13 0 1 14 0 0 15 0 0 16 0 0 17 0 0 18 0 1 19 0 0 20 0 0 21 0 0 22 2 3 23 0 0 May 05 00 0 1 01 0 1 02 0 0 03 0 1 04 0 1 05 1 4 06 0 4 07 1 3 08 0 0 09 1 0 10 0 1 11 0 0 12 0 1 13 0 0 14 0 0 15 0 0 16 0 0 17 0 0 18 0 0 19 0 0 20 0 0 21 0 1 22 0 0 23 0 0 May 06 00 1 1 01 4 16 02 3 11 03 2 5 04 2 5 05 1 2 06 0 0 07 0 2 08 1 0 09 0 0 10 1 0 11 0 0 12 0 0 13 0 0 14 0 0 15 0 0 16 0 1 17 0 0 18 0 0 19 0 0 20 0 0 21 0 0 22 0 0 23 0 0 May 07 00 2 1 01 0 1 02 0 1 03 0 4 04 0 1 05 0 4 06 0 1 07 1 1 08 0 1 09 0 0 10 1 1 11 1 2 12 0 1 13 0 0 14 0 0 15 0 0 16 0 0 17 0 0 18 0 0 19 0 0 20 0 0 21 1 3 22 0 0 23 0 0 May 08 00 0 2 01 0 1 02 1 2 03 0 1 04 0 2 05 0 3 06 0 0 07 0 1 08 0 1 09 0 0 10 0 0 11 0 1 12 1 0 13 0 2 14 0 2 15 0 1 16 0 0 17 0 0 18 0 0 19 0 0 20 0 0 21 0 0 22 0 1 23 0 3 May 09 00 1 0 01 0 1 02 0 1 03 0 1 04 0 2 05 0 4 06 0 1 07 0 0 08 0 1 09 0 1 10 1 0 11 0 0 12 0 1 13 0 0 14 0 0 15 0 0 16 0 0 17 0 0 18 0 0 19 0 0 20 0 0 21 1 0 22 0 1 23 0 0 - 10.98 sec Highest CPU-cost vacuum
-
Locks
Locks by types
Key values
- unknown Main Lock Type
- 0 locks Total
Most frequent waiting queries (N)
Rank Count Total time Min time Max time Avg duration Query NO DATASET
Queries that waited the most
Rank Wait time Query NO DATASET
-
Queries
Queries by type
Key values
- 284 Total read queries
- 234 Total write queries
Queries by database
Key values
- unknown Main database
- 270 Requests
- 4h36m54s (ctdprd51)
- Main time consuming database
Queries by user
Key values
- unknown Main user
- 676 Requests
User Request type Count Duration edit Total 2 11s674ms select 2 11s674ms editeu Total 20 2m19s select 20 2m19s load Total 2 10s465ms select 2 10s465ms postgres Total 92 1h37m38s copy to 92 1h37m38s pubc Total 9 1h26m37s select 9 1h26m37s pubeu Total 396 7h4m47s select 396 7h4m47s qaeu Total 32 3m5s select 32 3m5s unknown Total 676 8h6m37s copy to 520 7h25m48s others 9 1m select 147 39m49s Duration by user
Key values
- 8h6m37s (unknown) Main time consuming user
User Request type Count Duration edit Total 2 11s674ms select 2 11s674ms editeu Total 20 2m19s select 20 2m19s load Total 2 10s465ms select 2 10s465ms postgres Total 92 1h37m38s copy to 92 1h37m38s pubc Total 9 1h26m37s select 9 1h26m37s pubeu Total 396 7h4m47s select 396 7h4m47s qaeu Total 32 3m5s select 32 3m5s unknown Total 676 8h6m37s copy to 520 7h25m48s others 9 1m select 147 39m49s Queries by host
Key values
- unknown Main host
- 1,229 Requests
- 18h21m28s (unknown)
- Main time consuming host
Queries by application
Key values
- unknown Main application
- 476 Requests
- 5h9m24s (unknown)
- Main time consuming application
Number of cancelled queries
Key values
- 0 per second Cancelled query Peak
- 2026-05-05 06:32:38 Date
Number of cancelled queries (5 minutes period)
NO DATASET
-
Top Queries
Histogram of query times
Key values
- 285 > 10000ms duration
Slowest individual queries
Rank Duration Query 1 27m2s COPY pub2.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) TO stdout;[ Date: 2026-05-09 19:30:55 ]
2 26m52s COPY pub1.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) TO stdout;[ Date: 2026-05-09 18:44:34 ]
3 15m9s SELECT /* AdvancedGeneQueryDAO.getData */ g.id geneId, g.acc_txt acc, g.nm nm, g.nm nmHtml, g.secondary_nm secondaryNm, g.has_chems hasChems, g.has_diseases hasDiseases, g.has_exposures hasExposures, g.has_phenotypes hasPhenotypes, COUNT(*) OVER () fullRowCount FROM term g WHERE g.id IN ( SELECT gcr.gene_id FROM gene_chem_reference gcr WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MEX3A') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterDiseaseWhereEquals.Name.Gene */ gd.gene_id FROM term t INNER JOIN dag_path dp ON t.id = dp.ancestor_object_id INNER JOIN gene_disease gd ON dp.descendant_object_id = gd.disease_id WHERE UPPER(t.nm) LIKE 'CARCINOMA, HEPATOCELLULAR' AND t.object_type_id = 3 AND gd.curated_reference_qty > 0) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA01521' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7))) ORDER BY g.nm_sort, g.id LIMIT 50;[ Date: 2026-05-09 23:23:22 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
4 14m14s SELECT /* CIQH.getIxnCacheQuery */ gcr.ixn_id, NULL, gcr.gene_id, gcr.taxon_id FROM gene_chem_reference gcr WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MEX3A') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterDiseaseWhereEquals.Name.Gene */ gd.gene_id FROM term t INNER JOIN dag_path dp ON t.id = dp.ancestor_object_id INNER JOIN gene_disease gd ON dp.descendant_object_id = gd.disease_id WHERE UPPER(t.nm) LIKE 'CARCINOMA, HEPATOCELLULAR' AND t.object_type_id = 3 AND gd.curated_reference_qty > 0) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA01521' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7));[ Date: 2026-05-09 23:12:24 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
5 14m5s SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;[ Date: 2026-05-08 08:21:27 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
6 13m53s SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;[ Date: 2026-05-08 08:16:13 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
7 13m31s SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;[ Date: 2026-05-08 11:32:00 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
8 12m16s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-07 00:12:18 - Database: ctdprd51 - User: pubc - Application: psql ]
9 9m19s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-09 00:09:21 - Database: ctdprd51 - User: pubc - Application: psql ]
10 9m18s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-06 00:09:20 - Database: ctdprd51 - User: pubc - Application: psql ]
11 9m17s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-08 00:09:19 - Database: ctdprd51 - User: pubc - Application: psql ]
12 9m17s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-03 00:09:19 - Database: ctdprd51 - User: pubc - Application: psql ]
13 9m17s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-04 00:09:18 - Database: ctdprd51 - User: pubc - Application: psql ]
14 9m14s /* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();[ Date: 2026-05-05 00:09:15 - Database: ctdprd51 - User: pubc - Application: psql ]
15 6m57s COPY pub1.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) TO stdout;[ Date: 2026-05-09 18:57:02 ]
16 6m52s SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'SQSTM1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008152' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'ACETAMINOPHEN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;[ Date: 2026-05-08 15:14:39 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
17 6m49s COPY pub2.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) TO stdout;[ Date: 2026-05-09 19:43:22 ]
18 6m44s SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'SQSTM1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008152' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TRICHLOROETHYLENE' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;[ Date: 2026-05-08 14:54:19 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
19 6m35s SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'SQSTM1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008152' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TRICHLOROETHYLENE' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;[ Date: 2026-05-08 15:01:34 - Database: ctdprd51 - User: pubeu - Bind query: yes ]
20 5m52s SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;[ Date: 2026-05-03 03:45:47 - Bind query: yes ]
Time consuming queries (N)
Rank Total duration Times executed Min duration Max duration Avg duration Query 1 1h8m 7 9m14s 12m16s 9m42s select maint_query_logs_archive ();Times Reported Time consuming queries #1
Day Hour Count Duration Avg duration May 03 00 1 9m17s 9m17s May 04 00 1 9m17s 9m17s May 05 00 1 9m14s 9m14s May 06 00 1 9m18s 9m18s May 07 00 1 12m16s 12m16s May 08 00 1 9m17s 9m17s May 09 00 1 9m19s 9m19s [ User: pubc - Total duration: 1h8m - Times executed: 7 ]
[ Application: psql - Total duration: 1h8m - Times executed: 7 ]
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-07 00:12:18 Duration: 12m16s Database: ctdprd51 User: pubc Application: psql
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-09 00:09:21 Duration: 9m19s Database: ctdprd51 User: pubc Application: psql
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-06 00:09:20 Duration: 9m18s Database: ctdprd51 User: pubc Application: psql
2 48m40s 6 28s593ms 14m5s 8m6s select g.nm genesymbol, g.id geneid, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, c.nm chemnm, c.nm_html chemnmhtml, c.acc_txt chemacc, c.secondary_nm casrn, c.id chemid, i.id ixnid, i.ixn_prose_txt ixnprose, i.ixn_prose_html ixnprosehtml, i.actions_txt ixnactions, count(distinct gcr.reference_id) refcount, count(distinct gcr.taxon_id) taxoncount, ( select string_agg(distinct taxonterm.nm || ? || ? || ? || taxonterm.nm_html || ? || taxonterm.acc_txt || ? || taxonterm.acc_db_cd || ? || coalesce(taxonterm.secondary_nm, ?), ?)) as taxonterms, ( select string_agg(distinct r.acc_txt, ?)) as references, count(*) over () fullrowcount from gene_chem_reference gcr inner join ixn i on gcr.ixn_id = i.id inner join term g on gcr.gene_id = g.id inner join term c on gcr.chem_id = c.id inner join reference r on gcr.reference_id = r.id left outer join term taxonterm on gcr.taxon_id = taxonterm.id where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.chem_id = any (array ( select dp.descendant_object_id from dag_path dp inner join term t on t.id = dp.ancestor_object_id where upper(t.nm) like ? and t.object_type_id = ?)) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?)) group by g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id order by c.nm_sort, g.nm_sort, i.sort_txt limit ?;Times Reported Time consuming queries #2
Day Hour Count Duration Avg duration May 08 07 1 28s593ms 28s593ms 08 2 27m58s 13m59s 14 1 6m44s 6m44s 15 2 13m28s 6m44s [ User: pubeu - Total duration: 48m40s - Times executed: 6 ]
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 08:21:27 Duration: 14m5s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 08:16:13 Duration: 13m53s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'SQSTM1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008152' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'ACETAMINOPHEN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 15:14:39 Duration: 6m52s Database: ctdprd51 User: pubeu Bind query: yes
3 43m24s 46 12s420ms 5m52s 56s618ms select d.nm diseasenm, d.acc_txt diseaseacc, d.acc_db_cd diseaseaccdbcd, d.id diseaseid, g.nm genesymbol, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, g.id geneid, gd.network_score networkscore, gd.indirect_chem_qty inferredcount, gd.reference_qty referencecount, gd.exposure_reference_qty exposurereferencecount, case when gd.curated_reference_qty > ? then ( select string_agg(a.action_type_cd || ? || a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gd.gene_id and a.disease_id = gd.disease_id) else null end actiontypes from gene_disease gd inner join term g on gd.gene_id = g.id inner join term d on gd.disease_id = d.id where gd.disease_id in ( select p.descendant_object_id from dag_path p where p.ancestor_object_id = ?) order by actiontypes, gd.network_score desc nulls last, g.nm_sort, d.nm_sort;Times Reported Time consuming queries #3
Day Hour Count Duration Avg duration May 03 03 17 27m40s 1m37s 05 5 2m23s 28s792ms 11 8 4m2s 30s299ms May 04 04 4 3m21s 50s355ms 05 1 27s365ms 27s365ms May 05 06 4 1m40s 25s125ms 07 4 2m13s 33s270ms May 07 06 1 31s671ms 31s671ms 07 2 1m3s 31s569ms [ User: pubeu - Total duration: 33m23s - Times executed: 37 ]
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:47 Duration: 5m52s Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:47 Duration: 5m52s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:40 Duration: 5m46s Database: ctdprd51 User: pubeu Bind query: yes
4 39m9s 21 1m51s 1m53s 1m51s copy pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) to stdout;Times Reported Time consuming queries #4
Day Hour Count Duration Avg duration May 04 06 1 1m51s 1m51s 10 1 1m51s 1m51s 14 1 1m52s 1m52s 18 1 1m51s 1m51s May 05 06 1 1m51s 1m51s 10 1 1m52s 1m52s 14 1 1m51s 1m51s 18 1 1m51s 1m51s May 06 06 1 1m51s 1m51s 10 1 1m51s 1m51s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 07 06 1 1m52s 1m52s 10 1 1m52s 1m52s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 08 06 1 1m51s 1m51s 10 1 1m53s 1m53s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 09 19 1 1m51s 1m51s [ User: postgres - Total duration: 37m18s - Times executed: 20 ]
[ Application: pg_dump - Total duration: 37m18s - Times executed: 20 ]
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-08 10:06:55 Duration: 1m53s Database: ctdprd51 User: postgres Application: pg_dump
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-04 14:06:54 Duration: 1m52s Database: ctdprd51 User: postgres Application: pg_dump
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-05 10:06:53 Duration: 1m52s Database: ctdprd51 User: postgres Application: pg_dump
5 27m2s 1 27m2s 27m2s 27m2s copy pub2.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) to stdout;Times Reported Time consuming queries #5
Day Hour Count Duration Avg duration May 09 19 1 27m2s 27m2s -
COPY pub2.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) TO stdout;
Date: 2026-05-09 19:30:55 Duration: 27m2s
6 26m52s 1 26m52s 26m52s 26m52s copy pub1.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) to stdout;Times Reported Time consuming queries #6
Day Hour Count Duration Avg duration May 09 18 1 26m52s 26m52s -
COPY pub1.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) TO stdout;
Date: 2026-05-09 18:44:34 Duration: 26m52s
7 15m9s 1 15m9s 15m9s 15m9s select g.id geneid, g.acc_txt acc, g.nm nm, g.nm nmhtml, g.secondary_nm secondarynm, g.has_chems haschems, g.has_diseases hasdiseases, g.has_exposures hasexposures, g.has_phenotypes hasphenotypes, count(*) over () fullrowcount from term g where g.id in ( select gcr.gene_id from gene_chem_reference gcr where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select gd.gene_id from term t inner join dag_path dp on t.id = dp.ancestor_object_id inner join gene_disease gd on dp.descendant_object_id = gd.disease_id where upper(t.nm) like ? and t.object_type_id = ? and gd.curated_reference_qty > ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?))) order by g.nm_sort, g.id limit ?;Times Reported Time consuming queries #7
Day Hour Count Duration Avg duration May 09 23 1 15m9s 15m9s [ User: pubeu - Total duration: 15m9s - Times executed: 1 ]
-
SELECT /* AdvancedGeneQueryDAO.getData */ g.id geneId, g.acc_txt acc, g.nm nm, g.nm nmHtml, g.secondary_nm secondaryNm, g.has_chems hasChems, g.has_diseases hasDiseases, g.has_exposures hasExposures, g.has_phenotypes hasPhenotypes, COUNT(*) OVER () fullRowCount FROM term g WHERE g.id IN ( SELECT gcr.gene_id FROM gene_chem_reference gcr WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MEX3A') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterDiseaseWhereEquals.Name.Gene */ gd.gene_id FROM term t INNER JOIN dag_path dp ON t.id = dp.ancestor_object_id INNER JOIN gene_disease gd ON dp.descendant_object_id = gd.disease_id WHERE UPPER(t.nm) LIKE 'CARCINOMA, HEPATOCELLULAR' AND t.object_type_id = 3 AND gd.curated_reference_qty > 0) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA01521' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7))) ORDER BY g.nm_sort, g.id LIMIT 50;
Date: 2026-05-09 23:23:22 Duration: 15m9s Database: ctdprd51 User: pubeu Bind query: yes
8 14m55s 3 38s442ms 13m31s 4m58s select g.nm genesymbol, g.id geneid, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, c.nm chemnm, c.nm_html chemnmhtml, c.acc_txt chemacc, c.secondary_nm casrn, c.id chemid, i.id ixnid, i.ixn_prose_txt ixnprose, i.ixn_prose_html ixnprosehtml, i.actions_txt ixnactions, count(distinct gcr.reference_id) refcount, count(distinct gcr.taxon_id) taxoncount, ( select string_agg(distinct taxonterm.nm || ? || ? || ? || taxonterm.nm_html || ? || taxonterm.acc_txt || ? || taxonterm.acc_db_cd || ? || coalesce(taxonterm.secondary_nm, ?), ?)) as taxonterms, ( select string_agg(distinct r.acc_txt, ?)) as references, count(*) over () fullrowcount from gene_chem_reference gcr inner join ixn i on gcr.ixn_id = i.id inner join term g on gcr.gene_id = g.id inner join term c on gcr.chem_id = c.id inner join reference r on gcr.reference_id = r.id left outer join term taxonterm on gcr.taxon_id = taxonterm.id where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.chem_id = any (array ( select dp.descendant_object_id from dag_path dp inner join term t on t.id = dp.ancestor_object_id where upper(t.nm) like ? and t.object_type_id = ?)) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?)) and exists ( select ? from gene_chem_reference_axn gcra where gcr.id = gcra.gene_chem_reference_id and gcra.action_type_nm in ( select ac.nm from action_type ap, action_type ac where ac.subset_left_no between ap.subset_left_no and ap.subset_right_no and (ap.nm = ?))) group by g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id order by c.nm_sort, g.nm_sort, i.sort_txt limit ?;Times Reported Time consuming queries #8
Day Hour Count Duration Avg duration May 08 11 3 14m55s 4m58s [ User: pubeu - Total duration: 14m55s - Times executed: 3 ]
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 11:32:00 Duration: 13m31s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0003674' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 11:17:03 Duration: 45s923ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'promoter'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0003674' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 11:14:39 Duration: 38s442ms Database: ctdprd51 User: pubeu Bind query: yes
9 14m14s 1 14m14s 14m14s 14m14s select gcr.ixn_id, null, gcr.gene_id, gcr.taxon_id from gene_chem_reference gcr where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select gd.gene_id from term t inner join dag_path dp on t.id = dp.ancestor_object_id inner join gene_disease gd on dp.descendant_object_id = gd.disease_id where upper(t.nm) like ? and t.object_type_id = ? and gd.curated_reference_qty > ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?));Times Reported Time consuming queries #9
Day Hour Count Duration Avg duration May 09 23 1 14m14s 14m14s [ User: pubeu - Total duration: 14m14s - Times executed: 1 ]
-
SELECT /* CIQH.getIxnCacheQuery */ gcr.ixn_id, NULL, gcr.gene_id, gcr.taxon_id FROM gene_chem_reference gcr WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MEX3A') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterDiseaseWhereEquals.Name.Gene */ gd.gene_id FROM term t INNER JOIN dag_path dp ON t.id = dp.ancestor_object_id INNER JOIN gene_disease gd ON dp.descendant_object_id = gd.disease_id WHERE UPPER(t.nm) LIKE 'CARCINOMA, HEPATOCELLULAR' AND t.object_type_id = 3 AND gd.curated_reference_qty > 0) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA01521' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7));
Date: 2026-05-09 23:12:24 Duration: 14m14s Database: ctdprd51 User: pubeu Bind query: yes
10 8m24s 21 23s802ms 24s194ms 24s15ms copy pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) to stdout;Times Reported Time consuming queries #10
Day Hour Count Duration Avg duration May 04 06 1 23s909ms 23s909ms 10 1 23s947ms 23s947ms 14 1 24s39ms 24s39ms 18 1 23s860ms 23s860ms May 05 06 1 24s187ms 24s187ms 10 1 24s17ms 24s17ms 14 1 24s155ms 24s155ms 18 1 23s909ms 23s909ms May 06 06 1 23s889ms 23s889ms 10 1 24s72ms 24s72ms 14 1 24s175ms 24s175ms 18 1 24s194ms 24s194ms May 07 06 1 24s72ms 24s72ms 10 1 24s44ms 24s44ms 14 1 23s935ms 23s935ms 18 1 24s150ms 24s150ms May 08 06 1 23s853ms 23s853ms 10 1 24s141ms 24s141ms 14 1 23s886ms 23s886ms 18 1 24s89ms 24s89ms May 09 19 1 23s802ms 23s802ms -
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-06 18:07:18 Duration: 24s194ms
-
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-05 06:07:18 Duration: 24s187ms
-
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-06 14:07:18 Duration: 24s175ms
11 6m57s 1 6m57s 6m57s 6m57s copy pub1.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) to stdout;Times Reported Time consuming queries #11
Day Hour Count Duration Avg duration May 09 18 1 6m57s 6m57s -
COPY pub1.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) TO stdout;
Date: 2026-05-09 18:57:02 Duration: 6m57s
12 6m49s 1 6m49s 6m49s 6m49s copy pub2.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) to stdout;Times Reported Time consuming queries #12
Day Hour Count Duration Avg duration May 09 19 1 6m49s 6m49s -
COPY pub2.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) TO stdout;
Date: 2026-05-09 19:43:22 Duration: 6m49s
13 6m47s 21 19s312ms 19s570ms 19s427ms copy edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #13
Day Hour Count Duration Avg duration May 04 06 1 19s328ms 19s328ms 10 1 19s415ms 19s415ms 14 1 19s570ms 19s570ms 18 1 19s543ms 19s543ms May 05 06 1 19s312ms 19s312ms 10 1 19s448ms 19s448ms 14 1 19s332ms 19s332ms 18 1 19s430ms 19s430ms May 06 06 1 19s376ms 19s376ms 10 1 19s378ms 19s378ms 14 1 19s333ms 19s333ms 18 1 19s375ms 19s375ms May 07 06 1 19s457ms 19s457ms 10 1 19s547ms 19s547ms 14 1 19s476ms 19s476ms 18 1 19s482ms 19s482ms May 08 06 1 19s436ms 19s436ms 10 1 19s402ms 19s402ms 14 1 19s428ms 19s428ms 18 1 19s405ms 19s405ms May 09 18 1 19s492ms 19s492ms [ User: postgres - Total duration: 6m47s - Times executed: 21 ]
[ Application: pg_dump - Total duration: 6m47s - Times executed: 21 ]
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 14:00:21 Duration: 19s570ms Database: ctdprd51 User: postgres Application: pg_dump
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 10:00:21 Duration: 19s547ms Database: ctdprd51 User: postgres Application: pg_dump
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 18:00:21 Duration: 19s543ms Database: ctdprd51 User: postgres Application: pg_dump
14 6m3s 10 5s118ms 2m3s 36s382ms select ? "Input", d.nm "DiseaseName", d.acc_db_cd || ? || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( select string_agg(stm.slim_term_nm, ? order by stm.slim_term_nm) from slim_term_mapping stm where stm.mapped_term_id = d.id) "DiseaseCategories", case when gdr.via_chem_id is null then ( select string_agg(a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gdr.gene_id and a.disease_id = gdr.disease_id) else null end "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", string_agg(gdr.source_acc_txt, ? order by gdr.source_acc_txt) "OmimIDs", string_agg(distinct r.acc_txt, ?) "PubMedIDs" from gene_disease_reference gdr inner join term g on gdr.gene_id = g.id inner join term d on gdr.disease_id = d.id left outer join reference r on gdr.reference_id = r.id left outer join term c on gdr.via_chem_id = c.id where d.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) group by g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, case when gdr.via_chem_id is null then ( select string_agg(a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gdr.gene_id and a.disease_id = gdr.disease_id) else null end, c.nm, gdr.network_score order by d.nm_sort, g.nm, "DirectEvidence", c.nm;Times Reported Time consuming queries #14
Day Hour Count Duration Avg duration May 03 23 5 4m36s 55s277ms May 04 06 1 7s375ms 7s375ms May 05 04 1 26s92ms 26s92ms May 09 07 3 53s964ms 17s988ms [ User: pubeu - Total duration: 5m41s - Times executed: 9 ]
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'drug-induced liver injury' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2124981) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:45:02 Duration: 2m3s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'genital diseases' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2125602) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:41:13 Duration: 1m37s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'acute kidney injury' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2134928) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:57:51 Duration: 31s777ms Database: ctdprd51 User: pubeu Bind query: yes
15 5m24s 21 15s298ms 15s619ms 15s458ms copy pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) to stdout;Times Reported Time consuming queries #15
Day Hour Count Duration Avg duration May 04 06 1 15s390ms 15s390ms 10 1 15s422ms 15s422ms 14 1 15s479ms 15s479ms 18 1 15s355ms 15s355ms May 05 06 1 15s534ms 15s534ms 10 1 15s565ms 15s565ms 14 1 15s565ms 15s565ms 18 1 15s381ms 15s381ms May 06 06 1 15s376ms 15s376ms 10 1 15s541ms 15s541ms 14 1 15s503ms 15s503ms 18 1 15s619ms 15s619ms May 07 06 1 15s372ms 15s372ms 10 1 15s518ms 15s518ms 14 1 15s344ms 15s344ms 18 1 15s461ms 15s461ms May 08 06 1 15s441ms 15s441ms 10 1 15s550ms 15s550ms 14 1 15s406ms 15s406ms 18 1 15s506ms 15s506ms May 09 19 1 15s298ms 15s298ms -
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-06 18:07:34 Duration: 15s619ms
-
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-05 14:07:33 Duration: 15s565ms
-
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-05 10:07:33 Duration: 15s565ms
16 5m8s 21 14s580ms 14s832ms 14s688ms copy edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #16
Day Hour Count Duration Avg duration May 04 06 1 14s627ms 14s627ms 10 1 14s712ms 14s712ms 14 1 14s706ms 14s706ms 18 1 14s720ms 14s720ms May 05 06 1 14s611ms 14s611ms 10 1 14s640ms 14s640ms 14 1 14s668ms 14s668ms 18 1 14s712ms 14s712ms May 06 06 1 14s683ms 14s683ms 10 1 14s613ms 14s613ms 14 1 14s580ms 14s580ms 18 1 14s637ms 14s637ms May 07 06 1 14s716ms 14s716ms 10 1 14s669ms 14s669ms 14 1 14s777ms 14s777ms 18 1 14s701ms 14s701ms May 08 06 1 14s712ms 14s712ms 10 1 14s748ms 14s748ms 14 1 14s660ms 14s660ms 18 1 14s729ms 14s729ms May 09 18 1 14s832ms 14s832ms -
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-09 18:10:52 Duration: 14s832ms
-
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:00:52 Duration: 14s777ms
-
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:00:52 Duration: 14s748ms
17 5m4s 21 14s375ms 14s787ms 14s486ms copy edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #17
Day Hour Count Duration Avg duration May 04 06 1 14s466ms 14s466ms 10 1 14s454ms 14s454ms 14 1 14s375ms 14s375ms 18 1 14s470ms 14s470ms May 05 06 1 14s405ms 14s405ms 10 1 14s500ms 14s500ms 14 1 14s448ms 14s448ms 18 1 14s438ms 14s438ms May 06 06 1 14s499ms 14s499ms 10 1 14s461ms 14s461ms 14 1 14s441ms 14s441ms 18 1 14s458ms 14s458ms May 07 06 1 14s461ms 14s461ms 10 1 14s626ms 14s626ms 14 1 14s787ms 14s787ms 18 1 14s512ms 14s512ms May 08 06 1 14s496ms 14s496ms 10 1 14s568ms 14s568ms 14 1 14s391ms 14s391ms 18 1 14s538ms 14s538ms May 09 18 1 14s405ms 14s405ms -
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:01:07 Duration: 14s787ms
-
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 10:01:07 Duration: 14s626ms
-
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:01:07 Duration: 14s568ms
18 4m36s 4 1m8s 1m9s 1m9s select ii.cd, count(ii.id) cnt from ( select ot.cd, tl.term_id id from object_type ot inner join term_label tl on ot.id = tl.object_type_id where tl.nm_fts @@ to_tsquery(?, ?) union select ?, r.id from reference r where r.title_abstract_fts @@ to_tsquery(?, ?) or r.id in ( select rpr.reference_id from reference_party_role rpr inner join reference_party rp on rpr.reference_party_id = rp.id where (substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ?)) union select ot.cd, l.object_id from db_link l inner join object_type ot on l.object_type_id = ot.id where l.type_cd = ? and (upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ?)) ii group by ii.cd;Times Reported Time consuming queries #18
Day Hour Count Duration Avg duration May 06 12 4 4m36s 1m9s [ User: pubeu - Total duration: 3m28s - Times executed: 3 ]
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC & TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC &TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '>TR' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0_STRCA' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'XANTHINE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'DEHYDROGENASE/OXIDASE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OS=STRUTHIO' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CAMELUS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'AUSTRALIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OX=441894' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'GN=N308_04629' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PE=3' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'SV=1' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LRWFAGPQIRNVAALGGNI')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '>TR' OR upper(l.acc_txt) LIKE 'A0A093GXM0' OR upper(l.acc_txt) LIKE 'A0A093GXM0_STRCA' OR upper(l.acc_txt) LIKE 'XANTHINE' OR upper(l.acc_txt) LIKE 'DEHYDROGENASE/OXIDASE' OR upper(l.acc_txt) LIKE 'OS=STRUTHIO' OR upper(l.acc_txt) LIKE 'CAMELUS' OR upper(l.acc_txt) LIKE 'AUSTRALIS' OR upper(l.acc_txt) LIKE 'OX=441894' OR upper(l.acc_txt) LIKE 'GN=N308_04629' OR upper(l.acc_txt) LIKE 'PE=3' OR upper(l.acc_txt) LIKE 'SV=1' OR upper(l.acc_txt) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR upper(l.acc_txt) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR upper(l.acc_txt) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR upper(l.acc_txt) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR upper(l.acc_txt) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR upper(l.acc_txt) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR upper(l.acc_txt) LIKE 'LRWFAGPQIRNVAALGGNI')) ii GROUP BY ii.cd;
Date: 2026-05-06 12:23:32 Duration: 1m9s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC & TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC &TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '>TR' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0_STRCA' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'XANTHINE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'DEHYDROGENASE/OXIDASE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OS=STRUTHIO' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CAMELUS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'AUSTRALIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OX=441894' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'GN=N308_04629' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PE=3' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'SV=1' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LRWFAGPQIRNVAALGGNI')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '>TR' OR upper(l.acc_txt) LIKE 'A0A093GXM0' OR upper(l.acc_txt) LIKE 'A0A093GXM0_STRCA' OR upper(l.acc_txt) LIKE 'XANTHINE' OR upper(l.acc_txt) LIKE 'DEHYDROGENASE/OXIDASE' OR upper(l.acc_txt) LIKE 'OS=STRUTHIO' OR upper(l.acc_txt) LIKE 'CAMELUS' OR upper(l.acc_txt) LIKE 'AUSTRALIS' OR upper(l.acc_txt) LIKE 'OX=441894' OR upper(l.acc_txt) LIKE 'GN=N308_04629' OR upper(l.acc_txt) LIKE 'PE=3' OR upper(l.acc_txt) LIKE 'SV=1' OR upper(l.acc_txt) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR upper(l.acc_txt) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR upper(l.acc_txt) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR upper(l.acc_txt) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR upper(l.acc_txt) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR upper(l.acc_txt) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR upper(l.acc_txt) LIKE 'LRWFAGPQIRNVAALGGNI')) ii GROUP BY ii.cd;
Date: 2026-05-06 12:23:24 Duration: 1m9s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC & TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC &TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '>TR' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0_STRCA' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'XANTHINE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'DEHYDROGENASE/OXIDASE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OS=STRUTHIO' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CAMELUS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'AUSTRALIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OX=441894' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'GN=N308_04629' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PE=3' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'SV=1' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LRWFAGPQIRNVAALGGNI')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '>TR' OR upper(l.acc_txt) LIKE 'A0A093GXM0' OR upper(l.acc_txt) LIKE 'A0A093GXM0_STRCA' OR upper(l.acc_txt) LIKE 'XANTHINE' OR upper(l.acc_txt) LIKE 'DEHYDROGENASE/OXIDASE' OR upper(l.acc_txt) LIKE 'OS=STRUTHIO' OR upper(l.acc_txt) LIKE 'CAMELUS' OR upper(l.acc_txt) LIKE 'AUSTRALIS' OR upper(l.acc_txt) LIKE 'OX=441894' OR upper(l.acc_txt) LIKE 'GN=N308_04629' OR upper(l.acc_txt) LIKE 'PE=3' OR upper(l.acc_txt) LIKE 'SV=1' OR upper(l.acc_txt) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR upper(l.acc_txt) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR upper(l.acc_txt) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR upper(l.acc_txt) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR upper(l.acc_txt) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR upper(l.acc_txt) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR upper(l.acc_txt) LIKE 'LRWFAGPQIRNVAALGGNI')) ii GROUP BY ii.cd;
Date: 2026-05-06 12:24:36 Duration: 1m9s Database: ctdprd51 User: pubeu Bind query: yes
19 4m24s 2 2m11s 2m12s 2m12s select phenotypeterm.nm gonm, phenotypeterm.nm_html gonmhtml, phenotypeterm.acc_txt goacc, phenotypeterm.id goid, diseaseterm.nm diseasenm, diseaseterm.acc_txt diseaseacc, diseaseterm.acc_db_cd diseaseaccdbcd, diseaseterm.id diseaseid, via_gene_qty genenetworkcount, via_chem_qty chemnetworkcount, indirect_reference_qty referencecount, count(*) over () fullrowcount from phenotype_term pt inner join term phenotypeterm on pt.phenotype_id = phenotypeterm.id inner join term diseaseterm on pt.term_id = diseaseterm.id where phenotypeterm.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) and diseaseterm.object_type_id = ? order by chemnetworkcount desc, genenetworkcount desc limit ?;Times Reported Time consuming queries #19
Day Hour Count Duration Avg duration May 05 04 2 4m24s 2m12s [ User: pubeu - Total duration: 4m24s - Times executed: 2 ]
-
SELECT /* GoDiseasesDAO */ phenotypeTerm.nm goNm, phenotypeTerm.nm_html goNmHTML, phenotypeTerm.acc_txt goAcc, phenotypeTerm.id goId, diseaseTerm.nm diseaseNm, diseaseTerm.acc_txt diseaseAcc, diseaseTerm.acc_db_cd diseaseAccDBCd, diseaseTerm.id diseaseId, via_gene_qty geneNetworkCount, via_chem_qty chemNetworkCount, indirect_reference_qty referenceCount, COUNT(*) OVER () fullRowCount FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id IN ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = '1285294') and diseaseTerm.object_type_id = 3 ORDER BY chemNetworkCount desc, geneNetworkCount desc LIMIT 50;
Date: 2026-05-05 04:11:19 Duration: 2m12s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* GoDiseasesDAO */ phenotypeTerm.nm goNm, phenotypeTerm.nm_html goNmHTML, phenotypeTerm.acc_txt goAcc, phenotypeTerm.id goId, diseaseTerm.nm diseaseNm, diseaseTerm.acc_txt diseaseAcc, diseaseTerm.acc_db_cd diseaseAccDBCd, diseaseTerm.id diseaseId, via_gene_qty geneNetworkCount, via_chem_qty chemNetworkCount, indirect_reference_qty referenceCount, COUNT(*) OVER () fullRowCount FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id IN ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = '1285294') and diseaseTerm.object_type_id = 3 ORDER BY chemNetworkCount desc, geneNetworkCount desc LIMIT 50;
Date: 2026-05-05 04:05:49 Duration: 2m11s Database: ctdprd51 User: pubeu Bind query: yes
20 3m53s 42 5s22ms 8s455ms 5s552ms select t.id, t.object_type_id, t.acc_txt, t.acc_db_cd, t.nm, t.nm_sort, t.secondary_nm, t.description, t.note, l.nm from pub2.term t, pub2.term_label l where t.object_type_id = ? and t.id = l.term_id;Times Reported Time consuming queries #20
Day Hour Count Duration Avg duration May 04 11 2 12s643ms 6s321ms 13 11 1m1s 5s594ms 14 29 2m39s 5s483ms [ User: editeu - Total duration: 47s435ms - Times executed: 8 ]
-
select t.ID, t.OBJECT_TYPE_ID, t.ACC_TXT, t.ACC_DB_CD, t.NM, t.NM_SORT, t.SECONDARY_NM, t.DESCRIPTION, t.NOTE, l.NM from pub2.TERM t, pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID;
Date: 2026-05-04 13:53:13 Duration: 8s455ms Bind query: yes
-
select t.ID, t.OBJECT_TYPE_ID, t.ACC_TXT, t.ACC_DB_CD, t.NM, t.NM_SORT, t.SECONDARY_NM, t.DESCRIPTION, t.NOTE, l.NM from pub2.TERM t, pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID;
Date: 2026-05-04 14:01:42 Duration: 7s965ms Database: ctdprd51 User: editeu Bind query: yes
-
select t.ID, t.OBJECT_TYPE_ID, t.ACC_TXT, t.ACC_DB_CD, t.NM, t.NM_SORT, t.SECONDARY_NM, t.DESCRIPTION, t.NOTE, l.NM from pub2.TERM t, pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID;
Date: 2026-05-04 14:34:19 Duration: 7s320ms Bind query: yes
Most frequent queries (N)
Rank Times executed Total duration Min duration Max duration Avg duration Query 1 46 43m24s 12s420ms 5m52s 56s618ms select d.nm diseasenm, d.acc_txt diseaseacc, d.acc_db_cd diseaseaccdbcd, d.id diseaseid, g.nm genesymbol, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, g.id geneid, gd.network_score networkscore, gd.indirect_chem_qty inferredcount, gd.reference_qty referencecount, gd.exposure_reference_qty exposurereferencecount, case when gd.curated_reference_qty > ? then ( select string_agg(a.action_type_cd || ? || a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gd.gene_id and a.disease_id = gd.disease_id) else null end actiontypes from gene_disease gd inner join term g on gd.gene_id = g.id inner join term d on gd.disease_id = d.id where gd.disease_id in ( select p.descendant_object_id from dag_path p where p.ancestor_object_id = ?) order by actiontypes, gd.network_score desc nulls last, g.nm_sort, d.nm_sort;Times Reported Time consuming queries #1
Day Hour Count Duration Avg duration May 03 03 17 27m40s 1m37s 05 5 2m23s 28s792ms 11 8 4m2s 30s299ms May 04 04 4 3m21s 50s355ms 05 1 27s365ms 27s365ms May 05 06 4 1m40s 25s125ms 07 4 2m13s 33s270ms May 07 06 1 31s671ms 31s671ms 07 2 1m3s 31s569ms [ User: pubeu - Total duration: 33m23s - Times executed: 37 ]
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:47 Duration: 5m52s Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:47 Duration: 5m52s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:40 Duration: 5m46s Database: ctdprd51 User: pubeu Bind query: yes
2 42 3m53s 5s22ms 8s455ms 5s552ms select t.id, t.object_type_id, t.acc_txt, t.acc_db_cd, t.nm, t.nm_sort, t.secondary_nm, t.description, t.note, l.nm from pub2.term t, pub2.term_label l where t.object_type_id = ? and t.id = l.term_id;Times Reported Time consuming queries #2
Day Hour Count Duration Avg duration May 04 11 2 12s643ms 6s321ms 13 11 1m1s 5s594ms 14 29 2m39s 5s483ms [ User: editeu - Total duration: 47s435ms - Times executed: 8 ]
-
select t.ID, t.OBJECT_TYPE_ID, t.ACC_TXT, t.ACC_DB_CD, t.NM, t.NM_SORT, t.SECONDARY_NM, t.DESCRIPTION, t.NOTE, l.NM from pub2.TERM t, pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID;
Date: 2026-05-04 13:53:13 Duration: 8s455ms Bind query: yes
-
select t.ID, t.OBJECT_TYPE_ID, t.ACC_TXT, t.ACC_DB_CD, t.NM, t.NM_SORT, t.SECONDARY_NM, t.DESCRIPTION, t.NOTE, l.NM from pub2.TERM t, pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID;
Date: 2026-05-04 14:01:42 Duration: 7s965ms Database: ctdprd51 User: editeu Bind query: yes
-
select t.ID, t.OBJECT_TYPE_ID, t.ACC_TXT, t.ACC_DB_CD, t.NM, t.NM_SORT, t.SECONDARY_NM, t.DESCRIPTION, t.NOTE, l.NM from pub2.TERM t, pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID;
Date: 2026-05-04 14:34:19 Duration: 7s320ms Bind query: yes
3 25 2m19s 5s470ms 5s792ms 5s583ms select ? "Input", sqi.chem_nm "ChemicalName", sqi.chem_acc_txt "ChemicalID", sqi.casrn "CasRN", sqi.gene_symbol "GeneSymbol", sqi.gene_acc_txt "GeneID", sqi.ontology_nm "Ontology", sqi.go_term_nm "GoTermName", sqi.go_acc_txt "GoTermID" from ( with sq as ( select distinct c.id chem_id, c.nm chem_nm, c.acc_txt chem_acc_txt, c.secondary_nm casrn, c.nm_sort chem_nm_sort, gcr.gene_id, g.nm gene_symbol, g.acc_txt gene_acc_txt, g.nm_sort gene_symbol_sort from term c inner join gene_chem_reference gcr on c.id = gcr.chem_id inner join term g on gcr.gene_id = g.id where (c.id = ?)) select distinct sq.chem_nm, sq.chem_acc_txt, sq.casrn, sq.gene_symbol, sq.gene_acc_txt, gt.nm go_term_nm, gt.acc_txt go_acc_txt, sq.chem_nm_sort, sq.gene_symbol_sort, gt.nm_sort, d.nm ontology_nm from sq inner join gene_go_annot gga on sq.gene_id = gga.gene_id inner join dag_node gt on gga.go_term_id = gt.object_id inner join dag d on gt.dag_id = d.id where gga.is_not = false and (d.id = ? or d.id = ?) order by sq.chem_nm_sort, sq.gene_symbol_sort, d.nm, gt.nm_sort) sqi;Times Reported Time consuming queries #3
Day Hour Count Duration Avg duration May 03 03 1 5s604ms 5s604ms 05 2 11s303ms 5s651ms 06 1 5s522ms 5s522ms 11 2 11s288ms 5s644ms May 04 05 3 16s995ms 5s665ms May 05 05 2 11s102ms 5s551ms 06 1 5s611ms 5s611ms 07 1 5s640ms 5s640ms May 06 05 2 11s147ms 5s573ms May 07 05 2 11s261ms 5s630ms May 08 05 2 11s14ms 5s507ms 13 1 5s506ms 5s506ms 14 2 10s953ms 5s476ms 15 1 5s542ms 5s542ms May 09 05 2 11s97ms 5s548ms [ User: pubeu - Total duration: 1m23s - Times executed: 15 ]
[ User: qaeu - Total duration: 55s826ms - Times executed: 10 ]
-
SELECT /* BatchChemGODAO */ 'ddt' "Input", sqi.chem_nm "ChemicalName", sqi.chem_acc_txt "ChemicalID", sqi.casRN "CasRN", sqi.gene_symbol "GeneSymbol", sqi.gene_acc_txt "GeneID", sqi.ontology_nm "Ontology", sqi.go_term_nm "GoTermName", sqi.go_acc_txt "GoTermID" FROM ( WITH sq AS ( SELECT DISTINCT c.id chem_id, c.nm chem_nm, c.acc_txt chem_acc_txt, c.secondary_nm casRN, c.nm_sort chem_nm_sort, gcr.gene_id, g.nm gene_symbol, g.acc_txt gene_acc_txt, g.nm_sort gene_symbol_sort FROM term c INNER JOIN gene_chem_reference gcr ON c.id = gcr.chem_id INNER JOIN term g ON gcr.gene_id = g.id WHERE (c.id = 1339298)) SELECT DISTINCT sq.chem_nm, sq.chem_acc_txt, sq.casRN, sq.gene_symbol, sq.gene_acc_txt, gt.nm go_term_nm, gt.acc_txt go_acc_txt, sq.chem_nm_sort, sq.gene_symbol_sort, gt.nm_sort, d.nm ontology_nm FROM sq INNER JOIN gene_go_annot gga ON sq.gene_id = gga.gene_id INNER JOIN dag_node gt ON gga.go_term_id = gt.object_id INNER JOIN dag d ON gt.dag_id = d.id WHERE gga.is_not = false AND (d.id = 5 OR d.id = 4) ORDER BY sq.chem_nm_sort, sq.gene_symbol_sort, d.nm, gt.nm_sort) sqi;
Date: 2026-05-03 11:30:06 Duration: 5s792ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchChemGODAO */ 'ddt' "Input", sqi.chem_nm "ChemicalName", sqi.chem_acc_txt "ChemicalID", sqi.casRN "CasRN", sqi.gene_symbol "GeneSymbol", sqi.gene_acc_txt "GeneID", sqi.ontology_nm "Ontology", sqi.go_term_nm "GoTermName", sqi.go_acc_txt "GoTermID" FROM ( WITH sq AS ( SELECT DISTINCT c.id chem_id, c.nm chem_nm, c.acc_txt chem_acc_txt, c.secondary_nm casRN, c.nm_sort chem_nm_sort, gcr.gene_id, g.nm gene_symbol, g.acc_txt gene_acc_txt, g.nm_sort gene_symbol_sort FROM term c INNER JOIN gene_chem_reference gcr ON c.id = gcr.chem_id INNER JOIN term g ON gcr.gene_id = g.id WHERE (c.id = 1339298)) SELECT DISTINCT sq.chem_nm, sq.chem_acc_txt, sq.casRN, sq.gene_symbol, sq.gene_acc_txt, gt.nm go_term_nm, gt.acc_txt go_acc_txt, sq.chem_nm_sort, sq.gene_symbol_sort, gt.nm_sort, d.nm ontology_nm FROM sq INNER JOIN gene_go_annot gga ON sq.gene_id = gga.gene_id INNER JOIN dag_node gt ON gga.go_term_id = gt.object_id INNER JOIN dag d ON gt.dag_id = d.id WHERE gga.is_not = false AND (d.id = 5 OR d.id = 4) ORDER BY sq.chem_nm_sort, sq.gene_symbol_sort, d.nm, gt.nm_sort) sqi;
Date: 2026-05-04 05:43:40 Duration: 5s752ms Database: ctdprd51 User: qaeu Bind query: yes
-
SELECT /* BatchChemGODAO */ 'ddt' "Input", sqi.chem_nm "ChemicalName", sqi.chem_acc_txt "ChemicalID", sqi.casRN "CasRN", sqi.gene_symbol "GeneSymbol", sqi.gene_acc_txt "GeneID", sqi.ontology_nm "Ontology", sqi.go_term_nm "GoTermName", sqi.go_acc_txt "GoTermID" FROM ( WITH sq AS ( SELECT DISTINCT c.id chem_id, c.nm chem_nm, c.acc_txt chem_acc_txt, c.secondary_nm casRN, c.nm_sort chem_nm_sort, gcr.gene_id, g.nm gene_symbol, g.acc_txt gene_acc_txt, g.nm_sort gene_symbol_sort FROM term c INNER JOIN gene_chem_reference gcr ON c.id = gcr.chem_id INNER JOIN term g ON gcr.gene_id = g.id WHERE (c.id = 1339298)) SELECT DISTINCT sq.chem_nm, sq.chem_acc_txt, sq.casRN, sq.gene_symbol, sq.gene_acc_txt, gt.nm go_term_nm, gt.acc_txt go_acc_txt, sq.chem_nm_sort, sq.gene_symbol_sort, gt.nm_sort, d.nm ontology_nm FROM sq INNER JOIN gene_go_annot gga ON sq.gene_id = gga.gene_id INNER JOIN dag_node gt ON gga.go_term_id = gt.object_id INNER JOIN dag d ON gt.dag_id = d.id WHERE gga.is_not = false AND (d.id = 5 OR d.id = 4) ORDER BY sq.chem_nm_sort, sq.gene_symbol_sort, d.nm, gt.nm_sort) sqi;
Date: 2026-05-07 05:43:40 Duration: 5s751ms Database: ctdprd51 User: qaeu Bind query: yes
4 21 39m9s 1m51s 1m53s 1m51s copy pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) to stdout;Times Reported Time consuming queries #4
Day Hour Count Duration Avg duration May 04 06 1 1m51s 1m51s 10 1 1m51s 1m51s 14 1 1m52s 1m52s 18 1 1m51s 1m51s May 05 06 1 1m51s 1m51s 10 1 1m52s 1m52s 14 1 1m51s 1m51s 18 1 1m51s 1m51s May 06 06 1 1m51s 1m51s 10 1 1m51s 1m51s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 07 06 1 1m52s 1m52s 10 1 1m52s 1m52s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 08 06 1 1m51s 1m51s 10 1 1m53s 1m53s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 09 19 1 1m51s 1m51s [ User: postgres - Total duration: 37m18s - Times executed: 20 ]
[ Application: pg_dump - Total duration: 37m18s - Times executed: 20 ]
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-08 10:06:55 Duration: 1m53s Database: ctdprd51 User: postgres Application: pg_dump
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-04 14:06:54 Duration: 1m52s Database: ctdprd51 User: postgres Application: pg_dump
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-05 10:06:53 Duration: 1m52s Database: ctdprd51 User: postgres Application: pg_dump
5 21 8m24s 23s802ms 24s194ms 24s15ms copy pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) to stdout;Times Reported Time consuming queries #5
Day Hour Count Duration Avg duration May 04 06 1 23s909ms 23s909ms 10 1 23s947ms 23s947ms 14 1 24s39ms 24s39ms 18 1 23s860ms 23s860ms May 05 06 1 24s187ms 24s187ms 10 1 24s17ms 24s17ms 14 1 24s155ms 24s155ms 18 1 23s909ms 23s909ms May 06 06 1 23s889ms 23s889ms 10 1 24s72ms 24s72ms 14 1 24s175ms 24s175ms 18 1 24s194ms 24s194ms May 07 06 1 24s72ms 24s72ms 10 1 24s44ms 24s44ms 14 1 23s935ms 23s935ms 18 1 24s150ms 24s150ms May 08 06 1 23s853ms 23s853ms 10 1 24s141ms 24s141ms 14 1 23s886ms 23s886ms 18 1 24s89ms 24s89ms May 09 19 1 23s802ms 23s802ms -
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-06 18:07:18 Duration: 24s194ms
-
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-05 06:07:18 Duration: 24s187ms
-
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-06 14:07:18 Duration: 24s175ms
6 21 6m47s 19s312ms 19s570ms 19s427ms copy edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #6
Day Hour Count Duration Avg duration May 04 06 1 19s328ms 19s328ms 10 1 19s415ms 19s415ms 14 1 19s570ms 19s570ms 18 1 19s543ms 19s543ms May 05 06 1 19s312ms 19s312ms 10 1 19s448ms 19s448ms 14 1 19s332ms 19s332ms 18 1 19s430ms 19s430ms May 06 06 1 19s376ms 19s376ms 10 1 19s378ms 19s378ms 14 1 19s333ms 19s333ms 18 1 19s375ms 19s375ms May 07 06 1 19s457ms 19s457ms 10 1 19s547ms 19s547ms 14 1 19s476ms 19s476ms 18 1 19s482ms 19s482ms May 08 06 1 19s436ms 19s436ms 10 1 19s402ms 19s402ms 14 1 19s428ms 19s428ms 18 1 19s405ms 19s405ms May 09 18 1 19s492ms 19s492ms [ User: postgres - Total duration: 6m47s - Times executed: 21 ]
[ Application: pg_dump - Total duration: 6m47s - Times executed: 21 ]
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 14:00:21 Duration: 19s570ms Database: ctdprd51 User: postgres Application: pg_dump
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 10:00:21 Duration: 19s547ms Database: ctdprd51 User: postgres Application: pg_dump
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 18:00:21 Duration: 19s543ms Database: ctdprd51 User: postgres Application: pg_dump
7 21 5m24s 15s298ms 15s619ms 15s458ms copy pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) to stdout;Times Reported Time consuming queries #7
Day Hour Count Duration Avg duration May 04 06 1 15s390ms 15s390ms 10 1 15s422ms 15s422ms 14 1 15s479ms 15s479ms 18 1 15s355ms 15s355ms May 05 06 1 15s534ms 15s534ms 10 1 15s565ms 15s565ms 14 1 15s565ms 15s565ms 18 1 15s381ms 15s381ms May 06 06 1 15s376ms 15s376ms 10 1 15s541ms 15s541ms 14 1 15s503ms 15s503ms 18 1 15s619ms 15s619ms May 07 06 1 15s372ms 15s372ms 10 1 15s518ms 15s518ms 14 1 15s344ms 15s344ms 18 1 15s461ms 15s461ms May 08 06 1 15s441ms 15s441ms 10 1 15s550ms 15s550ms 14 1 15s406ms 15s406ms 18 1 15s506ms 15s506ms May 09 19 1 15s298ms 15s298ms -
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-06 18:07:34 Duration: 15s619ms
-
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-05 14:07:33 Duration: 15s565ms
-
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-05 10:07:33 Duration: 15s565ms
8 21 5m8s 14s580ms 14s832ms 14s688ms copy edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #8
Day Hour Count Duration Avg duration May 04 06 1 14s627ms 14s627ms 10 1 14s712ms 14s712ms 14 1 14s706ms 14s706ms 18 1 14s720ms 14s720ms May 05 06 1 14s611ms 14s611ms 10 1 14s640ms 14s640ms 14 1 14s668ms 14s668ms 18 1 14s712ms 14s712ms May 06 06 1 14s683ms 14s683ms 10 1 14s613ms 14s613ms 14 1 14s580ms 14s580ms 18 1 14s637ms 14s637ms May 07 06 1 14s716ms 14s716ms 10 1 14s669ms 14s669ms 14 1 14s777ms 14s777ms 18 1 14s701ms 14s701ms May 08 06 1 14s712ms 14s712ms 10 1 14s748ms 14s748ms 14 1 14s660ms 14s660ms 18 1 14s729ms 14s729ms May 09 18 1 14s832ms 14s832ms -
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-09 18:10:52 Duration: 14s832ms
-
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:00:52 Duration: 14s777ms
-
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:00:52 Duration: 14s748ms
9 21 5m4s 14s375ms 14s787ms 14s486ms copy edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #9
Day Hour Count Duration Avg duration May 04 06 1 14s466ms 14s466ms 10 1 14s454ms 14s454ms 14 1 14s375ms 14s375ms 18 1 14s470ms 14s470ms May 05 06 1 14s405ms 14s405ms 10 1 14s500ms 14s500ms 14 1 14s448ms 14s448ms 18 1 14s438ms 14s438ms May 06 06 1 14s499ms 14s499ms 10 1 14s461ms 14s461ms 14 1 14s441ms 14s441ms 18 1 14s458ms 14s458ms May 07 06 1 14s461ms 14s461ms 10 1 14s626ms 14s626ms 14 1 14s787ms 14s787ms 18 1 14s512ms 14s512ms May 08 06 1 14s496ms 14s496ms 10 1 14s568ms 14s568ms 14 1 14s391ms 14s391ms 18 1 14s538ms 14s538ms May 09 18 1 14s405ms 14s405ms -
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:01:07 Duration: 14s787ms
-
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 10:01:07 Duration: 14s626ms
-
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:01:07 Duration: 14s568ms
10 21 2m34s 7s331ms 7s433ms 7s364ms copy edit.ixn (id, ixn_type_id, parent_id, position_seq, root_id, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #10
Day Hour Count Duration Avg duration May 04 06 1 7s340ms 7s340ms 10 1 7s357ms 7s357ms 14 1 7s362ms 7s362ms 18 1 7s359ms 7s359ms May 05 06 1 7s353ms 7s353ms 10 1 7s338ms 7s338ms 14 1 7s346ms 7s346ms 18 1 7s364ms 7s364ms May 06 06 1 7s333ms 7s333ms 10 1 7s344ms 7s344ms 14 1 7s361ms 7s361ms 18 1 7s355ms 7s355ms May 07 06 1 7s375ms 7s375ms 10 1 7s334ms 7s334ms 14 1 7s429ms 7s429ms 18 1 7s433ms 7s433ms May 08 06 1 7s389ms 7s389ms 10 1 7s346ms 7s346ms 14 1 7s331ms 7s331ms 18 1 7s397ms 7s397ms May 09 18 1 7s400ms 7s400ms -
COPY edit.ixn (id, ixn_type_id, parent_id, position_seq, root_id, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 18:00:31 Duration: 7s433ms
-
COPY edit.ixn (id, ixn_type_id, parent_id, position_seq, root_id, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:00:31 Duration: 7s429ms
-
COPY edit.ixn (id, ixn_type_id, parent_id, position_seq, root_id, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-09 18:10:31 Duration: 7s400ms
11 21 2m15s 6s384ms 6s544ms 6s430ms copy edit.reference_ixn (id, reference_acc_txt, reference_acc_db_id, ixn_id, taxon_acc_txt, taxon_acc_db_id, evidence_cd, source_cd, field_cd, internal_note, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #11
Day Hour Count Duration Avg duration May 04 06 1 6s471ms 6s471ms 10 1 6s415ms 6s415ms 14 1 6s515ms 6s515ms 18 1 6s449ms 6s449ms May 05 06 1 6s429ms 6s429ms 10 1 6s411ms 6s411ms 14 1 6s408ms 6s408ms 18 1 6s414ms 6s414ms May 06 06 1 6s390ms 6s390ms 10 1 6s431ms 6s431ms 14 1 6s391ms 6s391ms 18 1 6s410ms 6s410ms May 07 06 1 6s420ms 6s420ms 10 1 6s396ms 6s396ms 14 1 6s394ms 6s394ms 18 1 6s419ms 6s419ms May 08 06 1 6s417ms 6s417ms 10 1 6s544ms 6s544ms 14 1 6s384ms 6s384ms 18 1 6s430ms 6s430ms May 09 18 1 6s486ms 6s486ms -
COPY edit.reference_ixn (id, reference_acc_txt, reference_acc_db_id, ixn_id, taxon_acc_txt, taxon_acc_db_id, evidence_cd, source_cd, field_cd, internal_note, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:01:15 Duration: 6s544ms
-
COPY edit.reference_ixn (id, reference_acc_txt, reference_acc_db_id, ixn_id, taxon_acc_txt, taxon_acc_db_id, evidence_cd, source_cd, field_cd, internal_note, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 14:01:14 Duration: 6s515ms
-
COPY edit.reference_ixn (id, reference_acc_txt, reference_acc_db_id, ixn_id, taxon_acc_txt, taxon_acc_db_id, evidence_cd, source_cd, field_cd, internal_note, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-09 18:11:15 Duration: 6s486ms
12 21 2m8s 6s53ms 6s264ms 6s104ms copy edit.ixn_action (ixn_id, action_type_id, action_degree_type_id, position_seq, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #12
Day Hour Count Duration Avg duration May 04 06 1 6s53ms 6s53ms 10 1 6s83ms 6s83ms 14 1 6s109ms 6s109ms 18 1 6s103ms 6s103ms May 05 06 1 6s71ms 6s71ms 10 1 6s107ms 6s107ms 14 1 6s87ms 6s87ms 18 1 6s115ms 6s115ms May 06 06 1 6s78ms 6s78ms 10 1 6s78ms 6s78ms 14 1 6s66ms 6s66ms 18 1 6s80ms 6s80ms May 07 06 1 6s108ms 6s108ms 10 1 6s129ms 6s129ms 14 1 6s264ms 6s264ms 18 1 6s132ms 6s132ms May 08 06 1 6s129ms 6s129ms 10 1 6s97ms 6s97ms 14 1 6s70ms 6s70ms 18 1 6s132ms 6s132ms May 09 18 1 6s101ms 6s101ms -
COPY edit.ixn_action (ixn_id, action_type_id, action_degree_type_id, position_seq, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:00:37 Duration: 6s264ms
-
COPY edit.ixn_action (ixn_id, action_type_id, action_degree_type_id, position_seq, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 18:00:37 Duration: 6s132ms
-
COPY edit.ixn_action (ixn_id, action_type_id, action_degree_type_id, position_seq, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 18:00:36 Duration: 6s132ms
13 21 1m52s 5s2ms 5s831ms 5s344ms select d.abbr dagabbr, d.nm dagnm, gt.level_min_no daglevelmin, gt.nm gonm, gt.nm_html gonmhtml, gt.acc_txt goacc, gt.object_id goid, te.corrected_p_val pvalcorrected, te.raw_p_val pvalraw, te.target_match_qty targetmatchqty, te.target_total_qty targettotalqty, te.background_match_qty backgroundmatchqty, te.background_total_qty backgroundtotalqty, count(*) over () fullrowcount from term_enrichment te inner join dag_node gt on te.enriched_term_id = gt.object_id inner join dag d on gt.dag_id = d.id where te.term_id = ? and te.enriched_object_type_id = ? order by te.corrected_p_val, d.abbr, gt.nm_sort limit ?;Times Reported Time consuming queries #13
Day Hour Count Duration Avg duration May 03 08 1 5s670ms 5s670ms May 05 06 2 10s555ms 5s277ms May 06 00 1 5s414ms 5s414ms 07 1 5s67ms 5s67ms 20 1 5s2ms 5s2ms 21 2 10s297ms 5s148ms May 07 21 1 5s86ms 5s86ms May 08 08 2 10s606ms 5s303ms 21 4 21s638ms 5s409ms 22 1 5s492ms 5s492ms May 09 05 1 5s431ms 5s431ms 14 3 16s145ms 5s381ms 22 1 5s831ms 5s831ms [ User: pubeu - Total duration: 1m30s - Times executed: 17 ]
-
SELECT /* ChemGODAO */ d.abbr dagAbbr, d.nm dagNm, gt.level_min_no dagLevelMin, gt.nm gonm, gt.nm_html gonmhtml, gt.acc_txt goacc, gt.object_id goid, te.corrected_p_val pValCorrected, te.raw_p_val pValRaw, te.target_match_qty targetmatchqty, te.target_total_qty targettotalqty, te.background_match_qty backgroundmatchqty, te.background_total_qty backgroundtotalqty, COUNT(*) OVER () fullRowCount FROM term_enrichment te INNER JOIN dag_node gt ON te.enriched_term_id = gt.object_id INNER JOIN dag d ON gt.dag_id = d.id WHERE te.term_id = '1341205' AND te.enriched_object_type_id = 5 ORDER BY te.corrected_p_val, d.abbr, gt.nm_sort LIMIT 50;
Date: 2026-05-09 22:07:26 Duration: 5s831ms Bind query: yes
-
SELECT /* ChemGODAO */ d.abbr dagAbbr, d.nm dagNm, gt.level_min_no dagLevelMin, gt.nm gonm, gt.nm_html gonmhtml, gt.acc_txt goacc, gt.object_id goid, te.corrected_p_val pValCorrected, te.raw_p_val pValRaw, te.target_match_qty targetmatchqty, te.target_total_qty targettotalqty, te.background_match_qty backgroundmatchqty, te.background_total_qty backgroundtotalqty, COUNT(*) OVER () fullRowCount FROM term_enrichment te INNER JOIN dag_node gt ON te.enriched_term_id = gt.object_id INNER JOIN dag d ON gt.dag_id = d.id WHERE te.term_id = '1304879' AND te.enriched_object_type_id = 5 ORDER BY te.corrected_p_val, d.abbr, gt.nm_sort LIMIT 50;
Date: 2026-05-03 08:31:09 Duration: 5s670ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* ChemGODAO */ d.abbr dagAbbr, d.nm dagNm, gt.level_min_no dagLevelMin, gt.nm gonm, gt.nm_html gonmhtml, gt.acc_txt goacc, gt.object_id goid, te.corrected_p_val pValCorrected, te.raw_p_val pValRaw, te.target_match_qty targetmatchqty, te.target_total_qty targettotalqty, te.background_match_qty backgroundmatchqty, te.background_total_qty backgroundtotalqty, COUNT(*) OVER () fullRowCount FROM term_enrichment te INNER JOIN dag_node gt ON te.enriched_term_id = gt.object_id INNER JOIN dag d ON gt.dag_id = d.id WHERE te.term_id = '1441366' AND te.enriched_object_type_id = 5 ORDER BY te.corrected_p_val, d.abbr, gt.nm_sort LIMIT 50;
Date: 2026-05-09 14:14:37 Duration: 5s553ms Database: ctdprd51 User: pubeu Bind query: yes
14 17 1m39s 5s13ms 7s219ms 5s850ms select d.nm diseasenm, d.acc_txt diseaseacc, d.acc_db_cd diseaseaccdbcd, d.id diseaseid, g.nm genesymbol, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, g.id geneid, gd.network_score networkscore, gd.indirect_chem_qty inferredcount, gd.reference_qty referencecount, gd.exposure_reference_qty exposurereferencecount, case when gd.curated_reference_qty > ? then ( select string_agg(a.action_type_cd || ? || a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gd.gene_id and a.disease_id = gd.disease_id) else null end actiontypes from gene_disease gd inner join term g on gd.gene_id = g.id inner join term d on gd.disease_id = d.id where gd.disease_id in ( select p.descendant_object_id from dag_path p where p.ancestor_object_id = ?) order by actiontypes, gd.network_score desc nulls last, g.nm_sort, d.nm_sort limit ?;Times Reported Time consuming queries #14
Day Hour Count Duration Avg duration May 03 01 12 1m6s 5s519ms May 04 08 1 7s23ms 7s23ms 19 3 21s142ms 7s47ms May 07 12 1 5s61ms 5s61ms [ User: pubeu - Total duration: 1m28s - Times executed: 15 ]
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2132003') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort LIMIT 50;
Date: 2026-05-04 19:36:41 Duration: 7s219ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2132003') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort LIMIT 50;
Date: 2026-05-04 08:50:38 Duration: 7s23ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2132003') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort LIMIT 50;
Date: 2026-05-04 19:36:46 Duration: 6s971ms Database: ctdprd51 User: pubeu Bind query: yes
15 12 1m14s 6s189ms 6s293ms 6s234ms select ii.cd, count(ii.id) cnt from ( select ot.cd, tl.term_id id from object_type ot inner join term_label tl on ot.id = tl.object_type_id where tl.nm_fts @@ to_tsquery(?, ?) union select ?, r.id from reference r where r.title_abstract_fts @@ to_tsquery(?, ?) or r.id in ( select rpr.reference_id from reference_party_role rpr inner join reference_party rp on rpr.reference_party_id = rp.id where (substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ?)) union select ot.cd, l.object_id from db_link l inner join object_type ot on l.object_type_id = ot.id where l.type_cd = ? and (upper(l.acc_txt) like ?)) ii group by ii.cd;Times Reported Time consuming queries #15
Day Hour Count Duration Avg duration May 04 00 3 18s743ms 6s247ms May 05 05 1 6s235ms 6s235ms 10 2 12s533ms 6s266ms May 06 09 4 24s841ms 6s210ms 11 1 6s192ms 6s192ms 15 1 6s272ms 6s272ms [ User: pubeu - Total duration: 1m2s - Times executed: 10 ]
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', 'CTD_GENES_DISEASES.TSV') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', 'CTD_GENES_DISEASES.TSV') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CTD_GENES_DISEASES.TSV')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE 'CTD_GENES_DISEASES.TSV')) ii GROUP BY ii.cd;
Date: 2026-05-04 00:50:44 Duration: 6s293ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '1_HYDROXYNAPHTHALENE') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '1_HYDROXYNAPHTHALENE') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '1_HYDROXYNAPHTHALENE')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '1_HYDROXYNAPHTHALENE')) ii GROUP BY ii.cd;
Date: 2026-05-05 10:06:00 Duration: 6s286ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', 'CTD_CHEM_GENE_IXNS.TSV') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', 'CTD_CHEM_GENE_IXNS.TSV') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CTD_CHEM_GENE_IXNS.TSV')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE 'CTD_CHEM_GENE_IXNS.TSV')) ii GROUP BY ii.cd;
Date: 2026-05-06 15:58:22 Duration: 6s272ms Database: ctdprd51 User: pubeu Bind query: yes
16 10 6m3s 5s118ms 2m3s 36s382ms select ? "Input", d.nm "DiseaseName", d.acc_db_cd || ? || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( select string_agg(stm.slim_term_nm, ? order by stm.slim_term_nm) from slim_term_mapping stm where stm.mapped_term_id = d.id) "DiseaseCategories", case when gdr.via_chem_id is null then ( select string_agg(a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gdr.gene_id and a.disease_id = gdr.disease_id) else null end "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", string_agg(gdr.source_acc_txt, ? order by gdr.source_acc_txt) "OmimIDs", string_agg(distinct r.acc_txt, ?) "PubMedIDs" from gene_disease_reference gdr inner join term g on gdr.gene_id = g.id inner join term d on gdr.disease_id = d.id left outer join reference r on gdr.reference_id = r.id left outer join term c on gdr.via_chem_id = c.id where d.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) group by g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, case when gdr.via_chem_id is null then ( select string_agg(a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gdr.gene_id and a.disease_id = gdr.disease_id) else null end, c.nm, gdr.network_score order by d.nm_sort, g.nm, "DirectEvidence", c.nm;Times Reported Time consuming queries #16
Day Hour Count Duration Avg duration May 03 23 5 4m36s 55s277ms May 04 06 1 7s375ms 7s375ms May 05 04 1 26s92ms 26s92ms May 09 07 3 53s964ms 17s988ms [ User: pubeu - Total duration: 5m41s - Times executed: 9 ]
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'drug-induced liver injury' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2124981) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:45:02 Duration: 2m3s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'genital diseases' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2125602) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:41:13 Duration: 1m37s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'acute kidney injury' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2134928) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:57:51 Duration: 31s777ms Database: ctdprd51 User: pubeu Bind query: yes
17 10 3m7s 6s981ms 36s386ms 18s780ms select ? AS "Input", phenotypeterm.nm AS "PhenotypeName", phenotypeterm.acc_txt AS "PhenotypeID", diseaseterm.nm AS "DiseaseName", diseaseterm.acc_db_cd || ? || diseaseterm.acc_txt "DiseaseID", ( select string_agg(distinct geneterm.nm, ?) from term geneterm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneterm.id and ptr.via_term_object_type_id = ?) AS "GeneInferenceNetwork", ( select string_agg(distinct chemterm.nm, ?) from term chemterm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemterm.id and ptr.via_term_object_type_id = ?) AS "ChemInferenceNetwork", ( select string_agg(distinct r.acc_txt, ?) from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" from phenotype_term pt inner join term phenotypeterm on pt.phenotype_id = phenotypeterm.id inner join term diseaseterm on pt.term_id = diseaseterm.id where phenotypeterm.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) and diseaseterm.object_type_id = ?;Times Reported Time consuming queries #17
Day Hour Count Duration Avg duration May 08 08 10 3m7s 18s780ms [ User: pubeu - Total duration: 2m14s - Times executed: 5 ]
-
SELECT /* BatchDiseasePhenotypeAssnsDAO */ 'apoptotic process' AS "Input", phenotypeTerm.nm as "PhenotypeName", phenotypeTerm.acc_txt as "PhenotypeID", diseaseTerm.nm as "DiseaseName", diseaseTerm.acc_db_cd || ':' || diseaseTerm.acc_txt "DiseaseID", ( SELECT STRING_AGG(distinct geneTerm.nm, '|') from term geneTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneTerm.id and ptr.via_term_object_type_id = 4) AS "GeneInferenceNetwork", ( SELECT STRING_AGG(distinct chemTerm.nm, '|') from term chemTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemTerm.id and ptr.via_term_object_type_id = 2) AS "ChemInferenceNetwork", ( SELECT STRING_AGG(distinct r.acc_txt, '|') from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 1285351) and diseaseTerm.object_type_id = 3;
Date: 2026-05-08 08:48:16 Duration: 36s386ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseasePhenotypeAssnsDAO */ 'apoptotic process' AS "Input", phenotypeTerm.nm as "PhenotypeName", phenotypeTerm.acc_txt as "PhenotypeID", diseaseTerm.nm as "DiseaseName", diseaseTerm.acc_db_cd || ':' || diseaseTerm.acc_txt "DiseaseID", ( SELECT STRING_AGG(distinct geneTerm.nm, '|') from term geneTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneTerm.id and ptr.via_term_object_type_id = 4) AS "GeneInferenceNetwork", ( SELECT STRING_AGG(distinct chemTerm.nm, '|') from term chemTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemTerm.id and ptr.via_term_object_type_id = 2) AS "ChemInferenceNetwork", ( SELECT STRING_AGG(distinct r.acc_txt, '|') from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 1285351) and diseaseTerm.object_type_id = 3;
Date: 2026-05-08 08:47:14 Duration: 35s986ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseasePhenotypeAssnsDAO */ 'cell population proliferation' AS "Input", phenotypeTerm.nm as "PhenotypeName", phenotypeTerm.acc_txt as "PhenotypeID", diseaseTerm.nm as "DiseaseName", diseaseTerm.acc_db_cd || ':' || diseaseTerm.acc_txt "DiseaseID", ( SELECT STRING_AGG(distinct geneTerm.nm, '|') from term geneTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneTerm.id and ptr.via_term_object_type_id = 4) AS "GeneInferenceNetwork", ( SELECT STRING_AGG(distinct chemTerm.nm, '|') from term chemTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemTerm.id and ptr.via_term_object_type_id = 2) AS "ChemInferenceNetwork", ( SELECT STRING_AGG(distinct r.acc_txt, '|') from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 1258827) and diseaseTerm.object_type_id = 3;
Date: 2026-05-08 08:48:39 Duration: 22s302ms Database: ctdprd51 User: pubeu Bind query: yes
18 7 1h8m 9m14s 12m16s 9m42s select maint_query_logs_archive ();Times Reported Time consuming queries #18
Day Hour Count Duration Avg duration May 03 00 1 9m17s 9m17s May 04 00 1 9m17s 9m17s May 05 00 1 9m14s 9m14s May 06 00 1 9m18s 9m18s May 07 00 1 12m16s 12m16s May 08 00 1 9m17s 9m17s May 09 00 1 9m19s 9m19s [ User: pubc - Total duration: 1h8m - Times executed: 7 ]
[ Application: psql - Total duration: 1h8m - Times executed: 7 ]
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-07 00:12:18 Duration: 12m16s Database: ctdprd51 User: pubc Application: psql
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-09 00:09:21 Duration: 9m19s Database: ctdprd51 User: pubc Application: psql
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-06 00:09:20 Duration: 9m18s Database: ctdprd51 User: pubc Application: psql
19 7 46s979ms 6s562ms 6s836ms 6s711ms vacuum analyze log_query_archive;Times Reported Time consuming queries #19
Day Hour Count Duration Avg duration May 03 00 1 6s836ms 6s836ms May 04 00 1 6s747ms 6s747ms May 05 00 1 6s626ms 6s626ms May 06 00 1 6s754ms 6s754ms May 07 00 1 6s685ms 6s685ms May 08 00 1 6s562ms 6s562ms May 09 00 1 6s766ms 6s766ms -
VACUUM ANALYZE log_query_archive;
Date: 2026-05-03 00:09:26 Duration: 6s836ms
-
VACUUM ANALYZE log_query_archive;
Date: 2026-05-09 00:09:28 Duration: 6s766ms
-
VACUUM ANALYZE log_query_archive;
Date: 2026-05-06 00:09:27 Duration: 6s754ms
20 6 48m40s 28s593ms 14m5s 8m6s select g.nm genesymbol, g.id geneid, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, c.nm chemnm, c.nm_html chemnmhtml, c.acc_txt chemacc, c.secondary_nm casrn, c.id chemid, i.id ixnid, i.ixn_prose_txt ixnprose, i.ixn_prose_html ixnprosehtml, i.actions_txt ixnactions, count(distinct gcr.reference_id) refcount, count(distinct gcr.taxon_id) taxoncount, ( select string_agg(distinct taxonterm.nm || ? || ? || ? || taxonterm.nm_html || ? || taxonterm.acc_txt || ? || taxonterm.acc_db_cd || ? || coalesce(taxonterm.secondary_nm, ?), ?)) as taxonterms, ( select string_agg(distinct r.acc_txt, ?)) as references, count(*) over () fullrowcount from gene_chem_reference gcr inner join ixn i on gcr.ixn_id = i.id inner join term g on gcr.gene_id = g.id inner join term c on gcr.chem_id = c.id inner join reference r on gcr.reference_id = r.id left outer join term taxonterm on gcr.taxon_id = taxonterm.id where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.chem_id = any (array ( select dp.descendant_object_id from dag_path dp inner join term t on t.id = dp.ancestor_object_id where upper(t.nm) like ? and t.object_type_id = ?)) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?)) group by g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id order by c.nm_sort, g.nm_sort, i.sort_txt limit ?;Times Reported Time consuming queries #20
Day Hour Count Duration Avg duration May 08 07 1 28s593ms 28s593ms 08 2 27m58s 13m59s 14 1 6m44s 6m44s 15 2 13m28s 6m44s [ User: pubeu - Total duration: 48m40s - Times executed: 6 ]
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 08:21:27 Duration: 14m5s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 08:16:13 Duration: 13m53s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'SQSTM1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008152' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'ACETAMINOPHEN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 15:14:39 Duration: 6m52s Database: ctdprd51 User: pubeu Bind query: yes
Normalized slowest queries (N)
Rank Min duration Max duration Avg duration Times executed Total duration Query 1 27m2s 27m2s 27m2s 1 27m2s copy pub2.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) to stdout;Times Reported Time consuming queries #1
Day Hour Count Duration Avg duration May 09 19 1 27m2s 27m2s -
COPY pub2.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) TO stdout;
Date: 2026-05-09 19:30:55 Duration: 27m2s
2 26m52s 26m52s 26m52s 1 26m52s copy pub1.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) to stdout;Times Reported Time consuming queries #2
Day Hour Count Duration Avg duration May 09 18 1 26m52s 26m52s -
COPY pub1.gene_disease_reference (id, gene_id, disease_id, reference_id, source_acc_txt, source_acc_db_id, via_chem_id, ixn_id, network_score, source_cd, mod_tm) TO stdout;
Date: 2026-05-09 18:44:34 Duration: 26m52s
3 15m9s 15m9s 15m9s 1 15m9s select g.id geneid, g.acc_txt acc, g.nm nm, g.nm nmhtml, g.secondary_nm secondarynm, g.has_chems haschems, g.has_diseases hasdiseases, g.has_exposures hasexposures, g.has_phenotypes hasphenotypes, count(*) over () fullrowcount from term g where g.id in ( select gcr.gene_id from gene_chem_reference gcr where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select gd.gene_id from term t inner join dag_path dp on t.id = dp.ancestor_object_id inner join gene_disease gd on dp.descendant_object_id = gd.disease_id where upper(t.nm) like ? and t.object_type_id = ? and gd.curated_reference_qty > ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?))) order by g.nm_sort, g.id limit ?;Times Reported Time consuming queries #3
Day Hour Count Duration Avg duration May 09 23 1 15m9s 15m9s [ User: pubeu - Total duration: 15m9s - Times executed: 1 ]
-
SELECT /* AdvancedGeneQueryDAO.getData */ g.id geneId, g.acc_txt acc, g.nm nm, g.nm nmHtml, g.secondary_nm secondaryNm, g.has_chems hasChems, g.has_diseases hasDiseases, g.has_exposures hasExposures, g.has_phenotypes hasPhenotypes, COUNT(*) OVER () fullRowCount FROM term g WHERE g.id IN ( SELECT gcr.gene_id FROM gene_chem_reference gcr WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MEX3A') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterDiseaseWhereEquals.Name.Gene */ gd.gene_id FROM term t INNER JOIN dag_path dp ON t.id = dp.ancestor_object_id INNER JOIN gene_disease gd ON dp.descendant_object_id = gd.disease_id WHERE UPPER(t.nm) LIKE 'CARCINOMA, HEPATOCELLULAR' AND t.object_type_id = 3 AND gd.curated_reference_qty > 0) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA01521' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7))) ORDER BY g.nm_sort, g.id LIMIT 50;
Date: 2026-05-09 23:23:22 Duration: 15m9s Database: ctdprd51 User: pubeu Bind query: yes
4 14m14s 14m14s 14m14s 1 14m14s select gcr.ixn_id, null, gcr.gene_id, gcr.taxon_id from gene_chem_reference gcr where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select gd.gene_id from term t inner join dag_path dp on t.id = dp.ancestor_object_id inner join gene_disease gd on dp.descendant_object_id = gd.disease_id where upper(t.nm) like ? and t.object_type_id = ? and gd.curated_reference_qty > ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?));Times Reported Time consuming queries #4
Day Hour Count Duration Avg duration May 09 23 1 14m14s 14m14s [ User: pubeu - Total duration: 14m14s - Times executed: 1 ]
-
SELECT /* CIQH.getIxnCacheQuery */ gcr.ixn_id, NULL, gcr.gene_id, gcr.taxon_id FROM gene_chem_reference gcr WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MEX3A') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterDiseaseWhereEquals.Name.Gene */ gd.gene_id FROM term t INNER JOIN dag_path dp ON t.id = dp.ancestor_object_id INNER JOIN gene_disease gd ON dp.descendant_object_id = gd.disease_id WHERE UPPER(t.nm) LIKE 'CARCINOMA, HEPATOCELLULAR' AND t.object_type_id = 3 AND gd.curated_reference_qty > 0) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA01521' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7));
Date: 2026-05-09 23:12:24 Duration: 14m14s Database: ctdprd51 User: pubeu Bind query: yes
5 9m14s 12m16s 9m42s 7 1h8m select maint_query_logs_archive ();Times Reported Time consuming queries #5
Day Hour Count Duration Avg duration May 03 00 1 9m17s 9m17s May 04 00 1 9m17s 9m17s May 05 00 1 9m14s 9m14s May 06 00 1 9m18s 9m18s May 07 00 1 12m16s 12m16s May 08 00 1 9m17s 9m17s May 09 00 1 9m19s 9m19s [ User: pubc - Total duration: 1h8m - Times executed: 7 ]
[ Application: psql - Total duration: 1h8m - Times executed: 7 ]
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-07 00:12:18 Duration: 12m16s Database: ctdprd51 User: pubc Application: psql
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-09 00:09:21 Duration: 9m19s Database: ctdprd51 User: pubc Application: psql
-
/* * Run daily to prune LOG_QUERY, archive old queries to LOG_QUERY_ARCHIVE * and vacuum/analyze the tables. * * $Id: archive_query_logs.sql 10832 2012-03-19 15:27:11Z mcr $ */ SELECT maint_query_logs_archive ();
Date: 2026-05-06 00:09:20 Duration: 9m18s Database: ctdprd51 User: pubc Application: psql
6 28s593ms 14m5s 8m6s 6 48m40s select g.nm genesymbol, g.id geneid, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, c.nm chemnm, c.nm_html chemnmhtml, c.acc_txt chemacc, c.secondary_nm casrn, c.id chemid, i.id ixnid, i.ixn_prose_txt ixnprose, i.ixn_prose_html ixnprosehtml, i.actions_txt ixnactions, count(distinct gcr.reference_id) refcount, count(distinct gcr.taxon_id) taxoncount, ( select string_agg(distinct taxonterm.nm || ? || ? || ? || taxonterm.nm_html || ? || taxonterm.acc_txt || ? || taxonterm.acc_db_cd || ? || coalesce(taxonterm.secondary_nm, ?), ?)) as taxonterms, ( select string_agg(distinct r.acc_txt, ?)) as references, count(*) over () fullrowcount from gene_chem_reference gcr inner join ixn i on gcr.ixn_id = i.id inner join term g on gcr.gene_id = g.id inner join term c on gcr.chem_id = c.id inner join reference r on gcr.reference_id = r.id left outer join term taxonterm on gcr.taxon_id = taxonterm.id where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.chem_id = any (array ( select dp.descendant_object_id from dag_path dp inner join term t on t.id = dp.ancestor_object_id where upper(t.nm) like ? and t.object_type_id = ?)) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?)) group by g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id order by c.nm_sort, g.nm_sort, i.sort_txt limit ?;Times Reported Time consuming queries #6
Day Hour Count Duration Avg duration May 08 07 1 28s593ms 28s593ms 08 2 27m58s 13m59s 14 1 6m44s 6m44s 15 2 13m28s 6m44s [ User: pubeu - Total duration: 48m40s - Times executed: 6 ]
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 08:21:27 Duration: 14m5s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'PRKN') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'PARAQUAT' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 08:16:13 Duration: 13m53s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'protein'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'SQSTM1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008152' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA05010' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'ACETAMINOPHEN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 15:14:39 Duration: 6m52s Database: ctdprd51 User: pubeu Bind query: yes
7 6m57s 6m57s 6m57s 1 6m57s copy pub1.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) to stdout;Times Reported Time consuming queries #7
Day Hour Count Duration Avg duration May 09 18 1 6m57s 6m57s -
COPY pub1.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) TO stdout;
Date: 2026-05-09 18:57:02 Duration: 6m57s
8 6m49s 6m49s 6m49s 1 6m49s copy pub2.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) to stdout;Times Reported Time consuming queries #8
Day Hour Count Duration Avg duration May 09 19 1 6m49s 6m49s -
COPY pub2.term_enrichment_agent (term_id, enriched_term_id, agent_term_id) TO stdout;
Date: 2026-05-09 19:43:22 Duration: 6m49s
9 38s442ms 13m31s 4m58s 3 14m55s select g.nm genesymbol, g.id geneid, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, c.nm chemnm, c.nm_html chemnmhtml, c.acc_txt chemacc, c.secondary_nm casrn, c.id chemid, i.id ixnid, i.ixn_prose_txt ixnprose, i.ixn_prose_html ixnprosehtml, i.actions_txt ixnactions, count(distinct gcr.reference_id) refcount, count(distinct gcr.taxon_id) taxoncount, ( select string_agg(distinct taxonterm.nm || ? || ? || ? || taxonterm.nm_html || ? || taxonterm.acc_txt || ? || taxonterm.acc_db_cd || ? || coalesce(taxonterm.secondary_nm, ?), ?)) as taxonterms, ( select string_agg(distinct r.acc_txt, ?)) as references, count(*) over () fullrowcount from gene_chem_reference gcr inner join ixn i on gcr.ixn_id = i.id inner join term g on gcr.gene_id = g.id inner join term c on gcr.chem_id = c.id inner join reference r on gcr.reference_id = r.id left outer join term taxonterm on gcr.taxon_id = taxonterm.id where exists ( select ? from gene_chem_ref_gene_form gf where gf.gene_chem_reference_id = gcr.id and gf.gene_id = gcr.gene_id and gf.actor_form_type_nm in ( select tc.nm from actor_form_type tp, actor_form_type tc where tc.subset_left_no between tp.subset_left_no and tp.subset_right_no and (tp.nm = ?))) and gcr.gene_id = any (array (( select gi.id gene_id from term gi where gi.object_type_id = ? and upper(gi.nm) like ?) intersect ( select ai.gene_id from dag_path pi inner join gene_go_annot ai on pi.descendant_object_id = ai.go_term_id inner join db_link dbli on dbli.object_id = pi.ancestor_object_id where dbli.acc_txt = ? and dbli.type_cd = ? and dbli.object_type_id = ?) intersect ( select tp.term_id from term_pathway tp where tp.object_type_id = ? and upper(tp.pathway_acc_txt) = ? and tp.pathway_acc_db_cd = ?))) and gcr.chem_id = any (array ( select dp.descendant_object_id from dag_path dp inner join term t on t.id = dp.ancestor_object_id where upper(t.nm) like ? and t.object_type_id = ?)) and gcr.taxon_id = any (array ( select dp.descendant_object_id from dag_path dp inner join dag_node n on n.id = dp.ancestor_dag_node_id where n.acc_txt = ? and n.dag_id = ?)) and exists ( select ? from gene_chem_reference_axn gcra where gcr.id = gcra.gene_chem_reference_id and gcra.action_type_nm in ( select ac.nm from action_type ap, action_type ac where ac.subset_left_no between ap.subset_left_no and ap.subset_right_no and (ap.nm = ?))) group by g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id order by c.nm_sort, g.nm_sort, i.sort_txt limit ?;Times Reported Time consuming queries #9
Day Hour Count Duration Avg duration May 08 11 3 14m55s 4m58s [ User: pubeu - Total duration: 14m55s - Times executed: 3 ]
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0008150' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 11:32:00 Duration: 13m31s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'gene'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0003674' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 11:17:03 Duration: 45s923ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* AdvancedIxnQueryDAO.getData */ g.nm geneSymbol, g.id geneId, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, c.nm chemNm, c.nm_html chemNmhtml, c.acc_txt chemAcc, c.secondary_nm casRN, c.id chemId, i.id ixnId, i.ixn_prose_txt ixnProse, i.ixn_prose_html ixnProseHtml, i.actions_txt ixnActions, COUNT(DISTINCT gcr.reference_id) refCount, COUNT(DISTINCT gcr.taxon_id) taxonCount, ( SELECT STRING_AGG(distinct taxonTerm.nm || '^' || 'taxon' || '^' || taxonTerm.nm_html || '^' || taxonTerm.acc_txt || '^' || taxonTerm.acc_db_cd || '^' || COALESCE(taxonTerm.secondary_nm, ''), '|')) as taxonTerms, ( SELECT STRING_AGG(distinct r.acc_txt, '|')) as references, COUNT(*) OVER () fullRowCount FROM gene_chem_reference gcr INNER JOIN ixn i ON gcr.ixn_id = i.id INNER JOIN term g ON gcr.gene_id = g.id INNER JOIN term c ON gcr.chem_id = c.id INNER JOIN reference r on gcr.reference_id = r.id LEFT OUTER JOIN term taxonTerm on gcr.taxon_id = taxonTerm.id WHERE /* CIQH.getIxnWhereCore */ EXISTS ( SELECT /* CIQH.getIxnGeneFormTypeWhere */ 1 FROM gene_chem_ref_gene_form gf WHERE gf.gene_chem_reference_id = gcr.id AND gf.gene_id = gcr.gene_id AND gf.actor_form_type_nm IN ( SELECT tc.nm FROM actor_form_type tp, actor_form_type tc WHERE tc.subset_left_no BETWEEN tp.subset_left_no AND tp.subset_right_no AND (tp.nm = 'promoter'))) AND gcr.gene_id = ANY (ARRAY (( SELECT /* CIQH.getIxnGeneWhereEquals.Name */ gi.id gene_id FROM term gi WHERE gi.object_type_id = 4 AND UPPER(gi.nm) LIKE 'MGAT1') INTERSECT ( SELECT /* IQH.getMasterGoWhereEquals.Gene */ ai.gene_id FROM dag_path pi INNER JOIN gene_go_annot ai ON pi.descendant_object_id = ai.go_term_id INNER JOIN db_link dbli ON dbli.object_id = pi.ancestor_object_id WHERE dbli.acc_txt = 'GO:0003674' AND dbli.type_cd = 'A' AND dbli.object_type_id = 5) INTERSECT ( SELECT /* IQH.getMasterPathwayWhereEquals.Acc */ tp.term_id FROM term_pathway tp WHERE tp.object_type_id = 4 AND UPPER(tp.pathway_acc_txt) = 'HSA04020' AND tp.pathway_acc_db_cd = 'KEGG'))) AND gcr.chem_id = ANY (ARRAY ( SELECT /* CIQH.getIxnChemWhereEquals.Name */ dp.descendant_object_id FROM dag_path dp INNER JOIN term t ON t.id = dp.ancestor_object_id WHERE UPPER(t.nm) LIKE 'TUNICAMYCIN' AND t.object_type_id = 2)) AND gcr.taxon_id = ANY (ARRAY ( SELECT /* CIQH.getIxnTaxonWhereEquals.Acc */ dp.descendant_object_id FROM dag_path dp INNER JOIN dag_node n ON n.id = dp.ancestor_dag_node_id WHERE n.acc_txt = '9606' AND n.dag_id = 7)) AND exists ( SELECT 1 FROM gene_chem_reference_axn gcra WHERE gcr.id = gcra.gene_chem_reference_id AND gcra.action_type_nm IN ( SELECT ac.nm FROM action_type ap, action_type ac WHERE ac.subset_left_no BETWEEN ap.subset_left_no AND ap.subset_right_no AND (ap.nm = 'N-linked glycosylation'))) GROUP BY g.nm, g.nm_sort, g.acc_txt, g.acc_db_cd, g.id, c.nm, c.nm_html, c.nm_sort, c.acc_txt, c.secondary_nm, c.id, i.ixn_prose_txt, i.ixn_prose_html, i.sort_txt, i.actions_txt, i.id ORDER BY c.nm_sort, g.nm_sort, i.sort_txt LIMIT 50;
Date: 2026-05-08 11:14:39 Duration: 38s442ms Database: ctdprd51 User: pubeu Bind query: yes
10 2m11s 2m12s 2m12s 2 4m24s select phenotypeterm.nm gonm, phenotypeterm.nm_html gonmhtml, phenotypeterm.acc_txt goacc, phenotypeterm.id goid, diseaseterm.nm diseasenm, diseaseterm.acc_txt diseaseacc, diseaseterm.acc_db_cd diseaseaccdbcd, diseaseterm.id diseaseid, via_gene_qty genenetworkcount, via_chem_qty chemnetworkcount, indirect_reference_qty referencecount, count(*) over () fullrowcount from phenotype_term pt inner join term phenotypeterm on pt.phenotype_id = phenotypeterm.id inner join term diseaseterm on pt.term_id = diseaseterm.id where phenotypeterm.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) and diseaseterm.object_type_id = ? order by chemnetworkcount desc, genenetworkcount desc limit ?;Times Reported Time consuming queries #10
Day Hour Count Duration Avg duration May 05 04 2 4m24s 2m12s [ User: pubeu - Total duration: 4m24s - Times executed: 2 ]
-
SELECT /* GoDiseasesDAO */ phenotypeTerm.nm goNm, phenotypeTerm.nm_html goNmHTML, phenotypeTerm.acc_txt goAcc, phenotypeTerm.id goId, diseaseTerm.nm diseaseNm, diseaseTerm.acc_txt diseaseAcc, diseaseTerm.acc_db_cd diseaseAccDBCd, diseaseTerm.id diseaseId, via_gene_qty geneNetworkCount, via_chem_qty chemNetworkCount, indirect_reference_qty referenceCount, COUNT(*) OVER () fullRowCount FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id IN ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = '1285294') and diseaseTerm.object_type_id = 3 ORDER BY chemNetworkCount desc, geneNetworkCount desc LIMIT 50;
Date: 2026-05-05 04:11:19 Duration: 2m12s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* GoDiseasesDAO */ phenotypeTerm.nm goNm, phenotypeTerm.nm_html goNmHTML, phenotypeTerm.acc_txt goAcc, phenotypeTerm.id goId, diseaseTerm.nm diseaseNm, diseaseTerm.acc_txt diseaseAcc, diseaseTerm.acc_db_cd diseaseAccDBCd, diseaseTerm.id diseaseId, via_gene_qty geneNetworkCount, via_chem_qty chemNetworkCount, indirect_reference_qty referenceCount, COUNT(*) OVER () fullRowCount FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id IN ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = '1285294') and diseaseTerm.object_type_id = 3 ORDER BY chemNetworkCount desc, geneNetworkCount desc LIMIT 50;
Date: 2026-05-05 04:05:49 Duration: 2m11s Database: ctdprd51 User: pubeu Bind query: yes
11 1m51s 1m53s 1m51s 21 39m9s copy pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) to stdout;Times Reported Time consuming queries #11
Day Hour Count Duration Avg duration May 04 06 1 1m51s 1m51s 10 1 1m51s 1m51s 14 1 1m52s 1m52s 18 1 1m51s 1m51s May 05 06 1 1m51s 1m51s 10 1 1m52s 1m52s 14 1 1m51s 1m51s 18 1 1m51s 1m51s May 06 06 1 1m51s 1m51s 10 1 1m51s 1m51s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 07 06 1 1m52s 1m52s 10 1 1m52s 1m52s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 08 06 1 1m51s 1m51s 10 1 1m53s 1m53s 14 1 1m51s 1m51s 18 1 1m52s 1m52s May 09 19 1 1m51s 1m51s [ User: postgres - Total duration: 37m18s - Times executed: 20 ]
[ Application: pg_dump - Total duration: 37m18s - Times executed: 20 ]
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-08 10:06:55 Duration: 1m53s Database: ctdprd51 User: postgres Application: pg_dump
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-04 14:06:54 Duration: 1m52s Database: ctdprd51 User: postgres Application: pg_dump
-
COPY pubc.log_query_archive (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, gene_set_txt, molecule_type_txt, volume_txt, first_page_txt, journal_query_type, journal_txt, is_review, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-05 10:06:53 Duration: 1m52s Database: ctdprd51 User: postgres Application: pg_dump
12 1m8s 1m9s 1m9s 4 4m36s select ii.cd, count(ii.id) cnt from ( select ot.cd, tl.term_id id from object_type ot inner join term_label tl on ot.id = tl.object_type_id where tl.nm_fts @@ to_tsquery(?, ?) union select ?, r.id from reference r where r.title_abstract_fts @@ to_tsquery(?, ?) or r.id in ( select rpr.reference_id from reference_party_role rpr inner join reference_party rp on rpr.reference_party_id = rp.id where (substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ? or substr(get_reference_party_nm_sort (rp.required_nm), ?, ?) like ?)) union select ot.cd, l.object_id from db_link l inner join object_type ot on l.object_type_id = ot.id where l.type_cd = ? and (upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ? or upper(l.acc_txt) like ?)) ii group by ii.cd;Times Reported Time consuming queries #12
Day Hour Count Duration Avg duration May 06 12 4 4m36s 1m9s [ User: pubeu - Total duration: 3m28s - Times executed: 3 ]
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC & TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC &TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '>TR' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0_STRCA' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'XANTHINE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'DEHYDROGENASE/OXIDASE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OS=STRUTHIO' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CAMELUS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'AUSTRALIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OX=441894' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'GN=N308_04629' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PE=3' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'SV=1' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LRWFAGPQIRNVAALGGNI')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '>TR' OR upper(l.acc_txt) LIKE 'A0A093GXM0' OR upper(l.acc_txt) LIKE 'A0A093GXM0_STRCA' OR upper(l.acc_txt) LIKE 'XANTHINE' OR upper(l.acc_txt) LIKE 'DEHYDROGENASE/OXIDASE' OR upper(l.acc_txt) LIKE 'OS=STRUTHIO' OR upper(l.acc_txt) LIKE 'CAMELUS' OR upper(l.acc_txt) LIKE 'AUSTRALIS' OR upper(l.acc_txt) LIKE 'OX=441894' OR upper(l.acc_txt) LIKE 'GN=N308_04629' OR upper(l.acc_txt) LIKE 'PE=3' OR upper(l.acc_txt) LIKE 'SV=1' OR upper(l.acc_txt) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR upper(l.acc_txt) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR upper(l.acc_txt) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR upper(l.acc_txt) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR upper(l.acc_txt) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR upper(l.acc_txt) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR upper(l.acc_txt) LIKE 'LRWFAGPQIRNVAALGGNI')) ii GROUP BY ii.cd;
Date: 2026-05-06 12:23:32 Duration: 1m9s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC & TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC &TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '>TR' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0_STRCA' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'XANTHINE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'DEHYDROGENASE/OXIDASE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OS=STRUTHIO' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CAMELUS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'AUSTRALIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OX=441894' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'GN=N308_04629' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PE=3' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'SV=1' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LRWFAGPQIRNVAALGGNI')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '>TR' OR upper(l.acc_txt) LIKE 'A0A093GXM0' OR upper(l.acc_txt) LIKE 'A0A093GXM0_STRCA' OR upper(l.acc_txt) LIKE 'XANTHINE' OR upper(l.acc_txt) LIKE 'DEHYDROGENASE/OXIDASE' OR upper(l.acc_txt) LIKE 'OS=STRUTHIO' OR upper(l.acc_txt) LIKE 'CAMELUS' OR upper(l.acc_txt) LIKE 'AUSTRALIS' OR upper(l.acc_txt) LIKE 'OX=441894' OR upper(l.acc_txt) LIKE 'GN=N308_04629' OR upper(l.acc_txt) LIKE 'PE=3' OR upper(l.acc_txt) LIKE 'SV=1' OR upper(l.acc_txt) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR upper(l.acc_txt) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR upper(l.acc_txt) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR upper(l.acc_txt) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR upper(l.acc_txt) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR upper(l.acc_txt) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR upper(l.acc_txt) LIKE 'LRWFAGPQIRNVAALGGNI')) ii GROUP BY ii.cd;
Date: 2026-05-06 12:23:24 Duration: 1m9s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BasicCountsDAO gen */ ii.cd, COUNT(ii.id) cnt FROM ( SELECT ot.cd, tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC & TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') UNION SELECT 'reference', r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english', '>TR & A0A093GXM0 & A0A093GXM0_STRCA & XANTHINE & DEHYDROGENASE/OXIDASE & OS=STRUTHIO & CAMELUS & AUSTRALIS & OX=441894 & GN=N308_04629 & PE=3 & SV=1 & MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS & KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC &TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG & TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP & PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM & LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ & LRWFAGPQIRNVAALGGNI') OR r.id IN ( SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE '>TR' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'A0A093GXM0_STRCA' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'XANTHINE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'DEHYDROGENASE/OXIDASE' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OS=STRUTHIO' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'CAMELUS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'AUSTRALIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'OX=441894' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'GN=N308_04629' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PE=3' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'SV=1' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR SUBSTR(get_reference_party_nm_sort (rp.required_nm), 1, 128) LIKE 'LRWFAGPQIRNVAALGGNI')) UNION SELECT ot.cd, l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper(l.acc_txt) LIKE '>TR' OR upper(l.acc_txt) LIKE 'A0A093GXM0' OR upper(l.acc_txt) LIKE 'A0A093GXM0_STRCA' OR upper(l.acc_txt) LIKE 'XANTHINE' OR upper(l.acc_txt) LIKE 'DEHYDROGENASE/OXIDASE' OR upper(l.acc_txt) LIKE 'OS=STRUTHIO' OR upper(l.acc_txt) LIKE 'CAMELUS' OR upper(l.acc_txt) LIKE 'AUSTRALIS' OR upper(l.acc_txt) LIKE 'OX=441894' OR upper(l.acc_txt) LIKE 'GN=N308_04629' OR upper(l.acc_txt) LIKE 'PE=3' OR upper(l.acc_txt) LIKE 'SV=1' OR upper(l.acc_txt) LIKE 'MAPERTGDELVFFVNGKKVVEKNADPETTLLTYLRRKLGLCGTKLGCGEGGCGACTVMIS' OR upper(l.acc_txt) LIKE 'KYNPFRKKILHYTANACLFPICALHHVAVTTVEGIGNTKSRLHPAQERIAKSHGSQCGFC' OR upper(l.acc_txt) LIKE 'TPGIVMSMYTLLRNKPEPKMEEIEDAFQGNLCRCTGYRPILEGYRTFAKDWGCCGRVANG' OR upper(l.acc_txt) LIKE 'TGCCRSEEENSMTGGCCEGKANGPGCCMNEKEDNVTMMSSSLFNPSEFQPLDPTQEPIFP' OR upper(l.acc_txt) LIKE 'PELMTQSNKQQKQLCFKGERVMWIQPTTLKELVALKSQYPSAKLVVGNTEVGIEMRLKNM' OR upper(l.acc_txt) LIKE 'LYPVIIAPAWISEMNAVQHTETGVNFGAACTLSSIEEVLRKAVAELPPYKTEVFQAVLEQ' OR upper(l.acc_txt) LIKE 'LRWFAGPQIRNVAALGGNI')) ii GROUP BY ii.cd;
Date: 2026-05-06 12:24:36 Duration: 1m9s Database: ctdprd51 User: pubeu Bind query: yes
13 12s420ms 5m52s 56s618ms 46 43m24s select d.nm diseasenm, d.acc_txt diseaseacc, d.acc_db_cd diseaseaccdbcd, d.id diseaseid, g.nm genesymbol, g.acc_txt geneacc, g.acc_db_cd geneaccdbcd, g.id geneid, gd.network_score networkscore, gd.indirect_chem_qty inferredcount, gd.reference_qty referencecount, gd.exposure_reference_qty exposurereferencecount, case when gd.curated_reference_qty > ? then ( select string_agg(a.action_type_cd || ? || a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gd.gene_id and a.disease_id = gd.disease_id) else null end actiontypes from gene_disease gd inner join term g on gd.gene_id = g.id inner join term d on gd.disease_id = d.id where gd.disease_id in ( select p.descendant_object_id from dag_path p where p.ancestor_object_id = ?) order by actiontypes, gd.network_score desc nulls last, g.nm_sort, d.nm_sort;Times Reported Time consuming queries #13
Day Hour Count Duration Avg duration May 03 03 17 27m40s 1m37s 05 5 2m23s 28s792ms 11 8 4m2s 30s299ms May 04 04 4 3m21s 50s355ms 05 1 27s365ms 27s365ms May 05 06 4 1m40s 25s125ms 07 4 2m13s 33s270ms May 07 06 1 31s671ms 31s671ms 07 2 1m3s 31s569ms [ User: pubeu - Total duration: 33m23s - Times executed: 37 ]
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:47 Duration: 5m52s Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:47 Duration: 5m52s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm, d.acc_txt diseaseAcc, d.acc_db_cd diseaseAccDbCd, d.id diseaseId, g.nm geneSymbol, g.acc_txt geneAcc, g.acc_db_cd geneAccDbCd, g.id geneId, gd.network_score networkScore, gd.indirect_chem_qty inferredCount, gd.reference_qty referenceCount, gd.exposure_reference_qty exposureReferenceCount, CASE WHEN gd.curated_reference_qty > 0 THEN ( SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN ( SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = '2124248') ORDER BY actionTypes, gd.network_score DESC NULLS LAST, g.nm_sort, d.nm_sort;
Date: 2026-05-03 03:45:40 Duration: 5m46s Database: ctdprd51 User: pubeu Bind query: yes
14 5s118ms 2m3s 36s382ms 10 6m3s select ? "Input", d.nm "DiseaseName", d.acc_db_cd || ? || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( select string_agg(stm.slim_term_nm, ? order by stm.slim_term_nm) from slim_term_mapping stm where stm.mapped_term_id = d.id) "DiseaseCategories", case when gdr.via_chem_id is null then ( select string_agg(a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gdr.gene_id and a.disease_id = gdr.disease_id) else null end "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", string_agg(gdr.source_acc_txt, ? order by gdr.source_acc_txt) "OmimIDs", string_agg(distinct r.acc_txt, ?) "PubMedIDs" from gene_disease_reference gdr inner join term g on gdr.gene_id = g.id inner join term d on gdr.disease_id = d.id left outer join reference r on gdr.reference_id = r.id left outer join term c on gdr.via_chem_id = c.id where d.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) group by g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, case when gdr.via_chem_id is null then ( select string_agg(a.action_type_nm, ?) from gene_disease_axn a where a.gene_id = gdr.gene_id and a.disease_id = gdr.disease_id) else null end, c.nm, gdr.network_score order by d.nm_sort, g.nm, "DirectEvidence", c.nm;Times Reported Time consuming queries #14
Day Hour Count Duration Avg duration May 03 23 5 4m36s 55s277ms May 04 06 1 7s375ms 7s375ms May 05 04 1 26s92ms 26s92ms May 09 07 3 53s964ms 17s988ms [ User: pubeu - Total duration: 5m41s - Times executed: 9 ]
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'drug-induced liver injury' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2124981) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:45:02 Duration: 2m3s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'genital diseases' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2125602) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:41:13 Duration: 1m37s Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseaseGeneAssnsDAO */ 'acute kidney injury' "Input", d.nm "DiseaseName", d.acc_db_cd || ':' || d.acc_txt "DiseaseID", g.nm "GeneSymbol", g.acc_txt "GeneID", ( SELECT STRING_AGG(stm.slim_term_nm, '|' ORDER BY stm.slim_term_nm) FROM slim_term_mapping stm WHERE stm.mapped_term_id = d.id) "DiseaseCategories", CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END "DirectEvidence", c.nm "InferenceChemicalName", gdr.network_score "InferenceScore", STRING_AGG(gdr.source_acc_txt, '|' ORDER BY gdr.source_acc_txt) "OmimIDs", STRING_AGG(DISTINCT r.acc_txt, '|') "PubMedIDs" FROM gene_disease_reference gdr INNER JOIN term g ON gdr.gene_id = g.id INNER JOIN term d ON gdr.disease_id = d.id LEFT OUTER JOIN reference r ON gdr.reference_id = r.id LEFT OUTER JOIN term c ON gdr.via_chem_id = c.id WHERE d.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 2134928) GROUP BY g.nm, g.acc_txt, d.nm, d.id, d.acc_txt, d.acc_db_cd, d.nm_sort, CASE WHEN gdr.via_chem_id IS NULL THEN ( SELECT STRING_AGG(a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gdr.gene_id AND a.disease_id = gdr.disease_id) ELSE NULL END, c.nm, gdr.network_score ORDER BY d.nm_sort, g.nm, "DirectEvidence", c.nm;
Date: 2026-05-03 23:57:51 Duration: 31s777ms Database: ctdprd51 User: pubeu Bind query: yes
15 23s802ms 24s194ms 24s15ms 21 8m24s copy pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) to stdout;Times Reported Time consuming queries #15
Day Hour Count Duration Avg duration May 04 06 1 23s909ms 23s909ms 10 1 23s947ms 23s947ms 14 1 24s39ms 24s39ms 18 1 23s860ms 23s860ms May 05 06 1 24s187ms 24s187ms 10 1 24s17ms 24s17ms 14 1 24s155ms 24s155ms 18 1 23s909ms 23s909ms May 06 06 1 23s889ms 23s889ms 10 1 24s72ms 24s72ms 14 1 24s175ms 24s175ms 18 1 24s194ms 24s194ms May 07 06 1 24s72ms 24s72ms 10 1 24s44ms 24s44ms 14 1 23s935ms 23s935ms 18 1 24s150ms 24s150ms May 08 06 1 23s853ms 23s853ms 10 1 24s141ms 24s141ms 14 1 23s886ms 23s886ms 18 1 24s89ms 24s89ms May 09 19 1 23s802ms 23s802ms -
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-06 18:07:18 Duration: 24s194ms
-
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-05 06:07:18 Duration: 24s187ms
-
COPY pubc.log_query_bots (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status) TO stdout;
Date: 2026-05-06 14:07:18 Duration: 24s175ms
16 19s312ms 19s570ms 19s427ms 21 6m47s copy edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #16
Day Hour Count Duration Avg duration May 04 06 1 19s328ms 19s328ms 10 1 19s415ms 19s415ms 14 1 19s570ms 19s570ms 18 1 19s543ms 19s543ms May 05 06 1 19s312ms 19s312ms 10 1 19s448ms 19s448ms 14 1 19s332ms 19s332ms 18 1 19s430ms 19s430ms May 06 06 1 19s376ms 19s376ms 10 1 19s378ms 19s378ms 14 1 19s333ms 19s333ms 18 1 19s375ms 19s375ms May 07 06 1 19s457ms 19s457ms 10 1 19s547ms 19s547ms 14 1 19s476ms 19s476ms 18 1 19s482ms 19s482ms May 08 06 1 19s436ms 19s436ms 10 1 19s402ms 19s402ms 14 1 19s428ms 19s428ms 18 1 19s405ms 19s405ms May 09 18 1 19s492ms 19s492ms [ User: postgres - Total duration: 6m47s - Times executed: 21 ]
[ Application: pg_dump - Total duration: 6m47s - Times executed: 21 ]
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 14:00:21 Duration: 19s570ms Database: ctdprd51 User: postgres Application: pg_dump
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 10:00:21 Duration: 19s547ms Database: ctdprd51 User: postgres Application: pg_dump
-
COPY edit.db_link (object_id, object_type_id, acc_txt, db_id, type_cd, is_primary, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-04 18:00:21 Duration: 19s543ms Database: ctdprd51 User: postgres Application: pg_dump
17 6s981ms 36s386ms 18s780ms 10 3m7s select ? AS "Input", phenotypeterm.nm AS "PhenotypeName", phenotypeterm.acc_txt AS "PhenotypeID", diseaseterm.nm AS "DiseaseName", diseaseterm.acc_db_cd || ? || diseaseterm.acc_txt "DiseaseID", ( select string_agg(distinct geneterm.nm, ?) from term geneterm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneterm.id and ptr.via_term_object_type_id = ?) AS "GeneInferenceNetwork", ( select string_agg(distinct chemterm.nm, ?) from term chemterm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemterm.id and ptr.via_term_object_type_id = ?) AS "ChemInferenceNetwork", ( select string_agg(distinct r.acc_txt, ?) from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" from phenotype_term pt inner join term phenotypeterm on pt.phenotype_id = phenotypeterm.id inner join term diseaseterm on pt.term_id = diseaseterm.id where phenotypeterm.id in ( select distinct dp.descendant_object_id from dag_path dp where dp.ancestor_object_id = ?) and diseaseterm.object_type_id = ?;Times Reported Time consuming queries #17
Day Hour Count Duration Avg duration May 08 08 10 3m7s 18s780ms [ User: pubeu - Total duration: 2m14s - Times executed: 5 ]
-
SELECT /* BatchDiseasePhenotypeAssnsDAO */ 'apoptotic process' AS "Input", phenotypeTerm.nm as "PhenotypeName", phenotypeTerm.acc_txt as "PhenotypeID", diseaseTerm.nm as "DiseaseName", diseaseTerm.acc_db_cd || ':' || diseaseTerm.acc_txt "DiseaseID", ( SELECT STRING_AGG(distinct geneTerm.nm, '|') from term geneTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneTerm.id and ptr.via_term_object_type_id = 4) AS "GeneInferenceNetwork", ( SELECT STRING_AGG(distinct chemTerm.nm, '|') from term chemTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemTerm.id and ptr.via_term_object_type_id = 2) AS "ChemInferenceNetwork", ( SELECT STRING_AGG(distinct r.acc_txt, '|') from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 1285351) and diseaseTerm.object_type_id = 3;
Date: 2026-05-08 08:48:16 Duration: 36s386ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseasePhenotypeAssnsDAO */ 'apoptotic process' AS "Input", phenotypeTerm.nm as "PhenotypeName", phenotypeTerm.acc_txt as "PhenotypeID", diseaseTerm.nm as "DiseaseName", diseaseTerm.acc_db_cd || ':' || diseaseTerm.acc_txt "DiseaseID", ( SELECT STRING_AGG(distinct geneTerm.nm, '|') from term geneTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneTerm.id and ptr.via_term_object_type_id = 4) AS "GeneInferenceNetwork", ( SELECT STRING_AGG(distinct chemTerm.nm, '|') from term chemTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemTerm.id and ptr.via_term_object_type_id = 2) AS "ChemInferenceNetwork", ( SELECT STRING_AGG(distinct r.acc_txt, '|') from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 1285351) and diseaseTerm.object_type_id = 3;
Date: 2026-05-08 08:47:14 Duration: 35s986ms Database: ctdprd51 User: pubeu Bind query: yes
-
SELECT /* BatchDiseasePhenotypeAssnsDAO */ 'cell population proliferation' AS "Input", phenotypeTerm.nm as "PhenotypeName", phenotypeTerm.acc_txt as "PhenotypeID", diseaseTerm.nm as "DiseaseName", diseaseTerm.acc_db_cd || ':' || diseaseTerm.acc_txt "DiseaseID", ( SELECT STRING_AGG(distinct geneTerm.nm, '|') from term geneTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = geneTerm.id and ptr.via_term_object_type_id = 4) AS "GeneInferenceNetwork", ( SELECT STRING_AGG(distinct chemTerm.nm, '|') from term chemTerm, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and ptr.via_term_id = chemTerm.id and ptr.via_term_object_type_id = 2) AS "ChemInferenceNetwork", ( SELECT STRING_AGG(distinct r.acc_txt, '|') from reference r, phenotype_term_reference ptr where pt.phenotype_id = ptr.phenotype_id and pt.term_id = ptr.term_id and (r.id = ptr.reference_id or r.id = ptr.term_reference_id)) AS "PubMedIDs" FROM phenotype_term pt inner join term phenotypeTerm on pt.phenotype_id = phenotypeTerm.id inner join term diseaseTerm on pt.term_id = diseaseTerm.id WHERE phenotypeTerm.id in ( select distinct dp.descendant_object_id from dag_path dp WHERE dp.ancestor_object_id = 1258827) and diseaseTerm.object_type_id = 3;
Date: 2026-05-08 08:48:39 Duration: 22s302ms Database: ctdprd51 User: pubeu Bind query: yes
18 15s298ms 15s619ms 15s458ms 21 5m24s copy pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) to stdout;Times Reported Time consuming queries #18
Day Hour Count Duration Avg duration May 04 06 1 15s390ms 15s390ms 10 1 15s422ms 15s422ms 14 1 15s479ms 15s479ms 18 1 15s355ms 15s355ms May 05 06 1 15s534ms 15s534ms 10 1 15s565ms 15s565ms 14 1 15s565ms 15s565ms 18 1 15s381ms 15s381ms May 06 06 1 15s376ms 15s376ms 10 1 15s541ms 15s541ms 14 1 15s503ms 15s503ms 18 1 15s619ms 15s619ms May 07 06 1 15s372ms 15s372ms 10 1 15s518ms 15s518ms 14 1 15s344ms 15s344ms 18 1 15s461ms 15s461ms May 08 06 1 15s441ms 15s441ms 10 1 15s550ms 15s550ms 14 1 15s406ms 15s406ms 18 1 15s506ms 15s506ms May 09 19 1 15s298ms 15s298ms -
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-06 18:07:34 Duration: 15s619ms
-
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-05 14:07:33 Duration: 15s565ms
-
COPY pubc.log_query_bots_original (id, type_cd, query_tm, submission_qty, session_id, remote_addr, http_user_agent, server_nm, node_nm, results_qty, execution_ms, basic_query_type, basic_query_txt, gene_query_type, gene_txt, gene_form_type_txt, taxon_query_type, taxon_txt, chem_query_type, chem_txt, party_query_type, party_nm_txt, acc_txt, go_query_type, go_txt, disease_query_type, disease_txt, action_type_txt, action_degree_type_txt, from_yr, through_yr, title_abstract_txt, has_marray, pathway_query_type, pathway_txt, dag_txt, results_format_txt, batch_input_type_txt, gd_assn_type, p_val, p_val_type, input_term_qty, review_status, user_agent_pattern) TO stdout;
Date: 2026-05-05 10:07:33 Duration: 15s565ms
19 14s580ms 14s832ms 14s688ms 21 5m8s copy edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #19
Day Hour Count Duration Avg duration May 04 06 1 14s627ms 14s627ms 10 1 14s712ms 14s712ms 14 1 14s706ms 14s706ms 18 1 14s720ms 14s720ms May 05 06 1 14s611ms 14s611ms 10 1 14s640ms 14s640ms 14 1 14s668ms 14s668ms 18 1 14s712ms 14s712ms May 06 06 1 14s683ms 14s683ms 10 1 14s613ms 14s613ms 14 1 14s580ms 14s580ms 18 1 14s637ms 14s637ms May 07 06 1 14s716ms 14s716ms 10 1 14s669ms 14s669ms 14 1 14s777ms 14s777ms 18 1 14s701ms 14s701ms May 08 06 1 14s712ms 14s712ms 10 1 14s748ms 14s748ms 14 1 14s660ms 14s660ms 18 1 14s729ms 14s729ms May 09 18 1 14s832ms 14s832ms -
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-09 18:10:52 Duration: 14s832ms
-
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:00:52 Duration: 14s777ms
-
COPY edit.ixn_actor (ixn_id, position_seq, object_type_id, acc_txt, acc_db_id, object_nm, actor_form_type_id, qual_actor_form_type_id, seq_acc_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:00:52 Duration: 14s748ms
20 14s375ms 14s787ms 14s486ms 21 5m4s copy edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) to stdout;Times Reported Time consuming queries #20
Day Hour Count Duration Avg duration May 04 06 1 14s466ms 14s466ms 10 1 14s454ms 14s454ms 14 1 14s375ms 14s375ms 18 1 14s470ms 14s470ms May 05 06 1 14s405ms 14s405ms 10 1 14s500ms 14s500ms 14 1 14s448ms 14s448ms 18 1 14s438ms 14s438ms May 06 06 1 14s499ms 14s499ms 10 1 14s461ms 14s461ms 14 1 14s441ms 14s441ms 18 1 14s458ms 14s458ms May 07 06 1 14s461ms 14s461ms 10 1 14s626ms 14s626ms 14 1 14s787ms 14s787ms 18 1 14s512ms 14s512ms May 08 06 1 14s496ms 14s496ms 10 1 14s568ms 14s568ms 14 1 14s391ms 14s391ms 18 1 14s538ms 14s538ms May 09 18 1 14s405ms 14s405ms -
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 14:01:07 Duration: 14s787ms
-
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-07 10:01:07 Duration: 14s626ms
-
COPY edit.reference (id, title, journal_nm, issue, pages_txt, page_position_seq, volume, pub_dt_format_mask, pub_start_dt, pub_end_dt, pub_start_season_nm, pub_end_season_nm, is_review, is_author_list_complete, affiliation_txt, abstract_txt, create_by, create_tm, mod_by, mod_tm) TO stdout;
Date: 2026-05-08 10:01:07 Duration: 14s568ms
Time consuming prepare
Rank Total duration Times executed Min duration Max duration Avg duration Query NO DATASET
Time consuming bind
Rank Total duration Times executed Min duration Max duration Avg duration Query 1 0ms 8 0ms 0ms 0ms ;Times Reported Time consuming bind #1
Day Hour Count Duration Avg duration May 06 12 8 0ms 0ms [ User: pubeu - Total duration: 6m56s - Times executed: 6 ]
-
;
Date: Duration: 0ms Database: postgres
-
Events
Log levels
Key values
- 57,164 Event entries
- (EVENTLOG entries are formaly LOG level entries that are not queries)
Events distribution (except queries)
Key values
- 0 PANIC entries
- 12 FATAL entries
- 16 ERROR entries
- 0 WARNING entries
- 32 EVENTLOG entries
Most Frequent Errors/Events
Key values
- 18 Max number of times the same event was reported
- 60 Total events found
Rank Times reported Error 1 18 LOG: could not receive data from client: Connection timed out
Times Reported Most Frequent Error / Event #1
Day Hour Count May 05 15 2 16 3 17 1 May 06 13 4 14 2 15 1 May 09 07 2 12 1 14 2 2 11 LOG: could not send data to client: Connection reset by peer
Times Reported Most Frequent Error / Event #2
Day Hour Count May 03 03 1 05 5 11 4 May 04 11 1 - LOG: could not send data to client: Connection reset by peer
- LOG: could not send data to client: Connection reset by peer
- LOG: could not send data to client: Connection reset by peer
Statement: SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = $1) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Date: 2026-05-03 03:46:19 Database: ctdprd51 Application: User: pubeu Remote:
Statement: SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id)
Date: 2026-05-03 05:57:19 Database: ctdprd51 Application: User: pubeu Remote:
Statement: SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = $1) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sortSELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p
Date: 2026-05-03 05:57:19 Database: ctdprd51 Application: User: pubeu Remote:
3 5 FATAL: connection to client lost
Times Reported Most Frequent Error / Event #3
Day Hour Count May 03 03 1 05 1 11 2 May 04 11 1 - FATAL: connection to client lost
- FATAL: connection to client lost
- FATAL: connection to client lost
Statement: SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = $1) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Date: 2026-05-03 03:46:19
Statement: SELECT /* DiseaseGeneAssnsDAO */ d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN
Date: 2026-05-03 05:57:19
Statement: select t.ID ,t.OBJECT_TYPE_ID ,t.ACC_TXT ,t.ACC_DB_CD ,t.NM ,t.NM_SORT ,t.SECONDARY_NM ,t.DESCRIPTION ,t.NOTE ,l.NM from pub2.TERM t ,pub2.TERM_LABEL l where t.OBJECT_TYPE_ID = 4 and t.id = l.TERM_ID
Date: 2026-05-04 11:41:24
4 4 ERROR: syntax error at or near "..."
Times Reported Most Frequent Error / Event #4
Day Hour Count May 04 16 1 May 05 10 2 May 06 11 1 - ERROR: syntax error at or near "identity" at character 56
- ERROR: syntax error at or near "DEFAULT" at character 90
- ERROR: syntax error at or near ")" at character 213
Statement: CREATE TABLE entity1( id_serial serial identity, id_int integer ) ;
Date: 2026-05-04 16:33:53
Statement: CREATE TABLE entity1( id_int integer, start_tm timestamp(6) , DEFAULT CURRENT_TIMESTAMP NOT NULL, end_tm timestamp(6) DEFAULT 'infinity'::timestamp(6) NOT NULL, );
Date: 2026-05-05 10:33:32
Statement: CREATE TABLE entity1( id_int integer, start_tm timestamp(6) DEFAULT CURRENT_TIMESTAMP NOT NULL, end_tm timestamp(6) DEFAULT 'infinity'::timestamp(6) NOT NULL, );
Date: 2026-05-05 10:34:12
5 3 ERROR: syntax error in ts"..."
Times Reported Most Frequent Error / Event #5
Day Hour Count May 08 23 1 May 09 22 2 - ERROR: syntax error in ts"OC & =O & CC & CP1 & =O & OC2=C & C=CC=C2 & C2=C1C=CC=C2 & C & O & =O & C1=C & C & =C & OC2=C & C & =C & C & =C2 & C & =C1 & |$_R1 & _R1 & _R1 & _R1 & _R1 & _R1 & _R1 & _R1 & _R1 & _R1$,C & 1,8,16,21,T & 5,12,LP & 7 & 2,RG & _R1= & BR:* & |$ & _AP1$,LP & 0 & 3 & ,LOG= & _R1 & H & 9 | CC1=CC=CC & OP & =O & OC2=CC & C & =CC=C2 & OC2=CC & C & =CC=C2 & =C1"
- ERROR: syntax error in ts"“THYROID & FUNCTION”& & MICROPLASTICS"
Statement: SELECT /* BasicCountsDAO gen */ ii.cd ,COUNT(ii.id) cnt FROM (SELECT ot.cd ,tl.term_id id FROM object_type ot INNER JOIN term_label tl ON ot.id = tl.object_type_id WHERE tl.nm_fts @@ to_tsquery('common.english_nostops',$1) UNION SELECT 'reference' ,r.id FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english',$2) OR r.id IN (SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE (SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $3 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $4 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $5 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $6 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $7 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $8 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $9 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $10 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $11 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $12 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $13 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $14 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $15 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $16 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $17 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $18 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $19 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $20 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $21 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $22 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $23 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $24 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $25 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $26 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $27 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $28 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $29 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $30 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $31 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $32 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $33 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $34 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $35 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $36 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $37 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $38 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $39 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $40 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $41 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $42 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $43 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $44 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $45 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $46 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $47 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $48 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $49 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $50 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $51 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $52 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $53 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $54 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $55 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $56 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $57 ) ) UNION SELECT ot.cd ,l.object_id FROM db_link l INNER JOIN object_type ot on l.object_type_id = ot.id WHERE l.type_cd = 'A' AND (upper( l.acc_txt ) LIKE $58 OR upper( l.acc_txt ) LIKE $59 OR upper( l.acc_txt ) LIKE $60 OR upper( l.acc_txt ) LIKE $61 OR upper( l.acc_txt ) LIKE $62 OR upper( l.acc_txt ) LIKE $63 OR upper( l.acc_txt ) LIKE $64 OR upper( l.acc_txt ) LIKE $65 OR upper( l.acc_txt ) LIKE $66 OR upper( l.acc_txt ) LIKE $67 OR upper( l.acc_txt ) LIKE $68 OR upper( l.acc_txt ) LIKE $69 OR upper( l.acc_txt ) LIKE $70 OR upper( l.acc_txt ) LIKE $71 OR upper( l.acc_txt ) LIKE $72 OR upper( l.acc_txt ) LIKE $73 OR upper( l.acc_txt ) LIKE $74 OR upper( l.acc_txt ) LIKE $75 OR upper( l.acc_txt ) LIKE $76 OR upper( l.acc_txt ) LIKE $77 OR upper( l.acc_txt ) LIKE $78 OR upper( l.acc_txt ) LIKE $79 OR upper( l.acc_txt ) LIKE $80 OR upper( l.acc_txt ) LIKE $81 OR upper( l.acc_txt ) LIKE $82 OR upper( l.acc_txt ) LIKE $83 OR upper( l.acc_txt ) LIKE $84 OR upper( l.acc_txt ) LIKE $85 OR upper( l.acc_txt ) LIKE $86 OR upper( l.acc_txt ) LIKE $87 OR upper( l.acc_txt ) LIKE $88 OR upper( l.acc_txt ) LIKE $89 OR upper( l.acc_txt ) LIKE $90 OR upper( l.acc_txt ) LIKE $91 OR upper( l.acc_txt ) LIKE $92 OR upper( l.acc_txt ) LIKE $93 OR upper( l.acc_txt ) LIKE $94 OR upper( l.acc_txt ) LIKE $95 OR upper( l.acc_txt ) LIKE $96 OR upper( l.acc_txt ) LIKE $97 OR upper( l.acc_txt ) LIKE $98 OR upper( l.acc_txt ) LIKE $99 OR upper( l.acc_txt ) LIKE $100 OR upper( l.acc_txt ) LIKE $101 OR upper( l.acc_txt ) LIKE $102 OR upper( l.acc_txt ) LIKE $103 OR upper( l.acc_txt ) LIKE $104 OR upper( l.acc_txt ) LIKE $105 OR upper( l.acc_txt ) LIKE $106 OR upper( l.acc_txt ) LIKE $107 OR upper( l.acc_txt ) LIKE $108 OR upper( l.acc_txt ) LIKE $109 OR upper( l.acc_txt ) LIKE $110 OR upper( l.acc_txt ) LIKE $111 OR upper( l.acc_txt ) LIKE $112 ) ) ii GROUP BY ii.cd
Date: 2026-05-08 23:16:06
Statement: SELECT /* ReferenceBasicQueryDAO */ i.title ,i.authors_txt authors ,i.core_citation_txt citation ,i.id ,i.acc_txt refacc ,i.isCurated ,i.pub_start_yr yr ,COUNT(*) OVER() fullRowCount FROM (SELECT r.title ,r.authors_txt ,r.core_citation_txt ,r.id ,r.acc_txt ,r.acc_db_cd ,r.has_diseases or r.has_ixns or r.has_exposures or r.has_phenotypes isCurated ,r.pub_start_yr ,r.sort_txt FROM reference r WHERE r.title_abstract_fts @@ to_tsquery('pg_catalog.english',$1) UNION SELECT r.title ,r.authors_txt ,r.core_citation_txt ,r.id ,r.acc_txt ,r.acc_db_cd ,r.has_diseases or r.has_ixns or r.has_exposures or r.has_phenotypes isCurated ,r.pub_start_yr ,r.sort_txt FROM reference r WHERE r.id IN (SELECT rpr.reference_id FROM reference_party_role rpr INNER JOIN reference_party rp ON rpr.reference_party_id = rp.id WHERE SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $2 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $3 OR SUBSTR(get_reference_party_nm_sort(rp.required_nm),1,128) LIKE $4 ) UNION SELECT r.title ,r.authors_txt ,r.core_citation_txt ,r.id ,r.acc_txt ,r.acc_db_cd ,r.has_diseases or r.has_ixns or r.has_exposures or r.has_phenotypes isCurated ,r.pub_start_yr ,r.sort_txt FROM reference r WHERE r.id IN (SELECT l.object_id FROM db_link l WHERE l.type_cd = 'A' AND l.object_type_id = 7 AND (upper( l.acc_txt ) = $5 OR upper( l.acc_txt ) = $6 OR upper( l.acc_txt ) = $7 ) ) ORDER BY 9) i LIMIT 50
Date: 2026-05-09 22:03:39 Database: ctdprd51 Application: User: pubeu Remote:
6 3 ERROR: relation "..." does not exist
Times Reported Most Frequent Error / Event #6
Day Hour Count May 05 13 2 May 06 12 1 - ERROR: relation "new_bots" does not exist at character 15
- ERROR: relation "excluded_remote_addr" does not exist at character 15
- ERROR: relation "db" does not exist at character 58
Statement: select * from new_bots
Date: 2026-05-05 13:09:23
Statement: select * from excluded_remote_addr
Date: 2026-05-05 13:09:43
Statement: SELECT r.acc_txt AS reference_acc_txt ,(SELECT id FROM db WHERE cd = r.acc_db_cd) AS reference_acc_db_id ,COALESCE(common.email_substr(r.affiliation_txt), common.email_substr(r.abstract_txt)) AS email_addr ,'D' AS source_cd ,'twiegers' AS create_by ,CURRENT_TIMESTAMP AS create_tm ,'twiegers' AS mod_by ,CURRENT_TIMESTAMP AS mod_tm -- !! CHANGE PUB SCHEMA QUALIFIER TO LIVE/QA SCHEMA !! FROM pub2.reference r WHERE NOT EXISTS (SELECT 1 FROM edit.reference_contact rc WHERE rc.reference_acc_txt = r.acc_txt) AND COALESCE(common.email_substr(r.affiliation_txt), common.email_substr(r.abstract_txt)) IS NOT NULL AND (r.has_diseases OR r.has_ixns OR r.has_exposures OR r.has_phenotypes) -- Curated only! (i.e., no BioGRID refs) ORDER BY email_addr;
Date: 2026-05-06 12:36:22 Database: ctdprd51 Application: pgAdmin 4 - CONN:9784952 User: load Remote:
7 3 LOG: could not receive data from client: Connection reset by peer
Times Reported Most Frequent Error / Event #7
Day Hour Count May 05 06 2 07 1 8 2 FATAL: connection to client lost d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (...) FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (...) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Times Reported Most Frequent Error / Event #8
Day Hour Count May 03 11 2 - FATAL: connection to client lost d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = ) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Statement: SELECT /* DiseaseGeneAssnsDAO */
Date: 2026-05-03 11:26:19
9 2 FATAL: canceling authentication due to timeout
Times Reported Most Frequent Error / Event #9
Day Hour Count May 05 07 1 May 09 09 1 10 2 ERROR: type "..." does not exist
Times Reported Most Frequent Error / Event #10
Day Hour Count May 04 16 2 - ERROR: type "identity" does not exist at character 73
- ERROR: type "identity" does not exist at character 49
Statement: CREATE TABLE entity1( id_serial serial, id_identity identity, id_int integer ) ;
Date: 2026-05-04 16:32:55 Database: ctdprd51 Application: pgAdmin 4 - CONN:9856821 User: load Remote:
Statement: CREATE TABLE entity1( id_serial identity, id_int integer ) ;
Date: 2026-05-04 16:34:15
11 1 ERROR: syntax error at end of input
Times Reported Most Frequent Error / Event #11
Day Hour Count May 06 10 1 - ERROR: syntax error at end of input at character 124
Statement: select remote_addr, count(*) from log_query where query_tm >= '20260423' group by remote_addr order by count(*) desc limit
Date: 2026-05-06 10:54:45 Database: ctdprd51 Application: pgAdmin 4 - CONN:1946658 User: pubc Remote:
12 1 ERROR: missing FROM-clause entry for table "..."
Times Reported Most Frequent Error / Event #12
Day Hour Count May 06 10 1 - ERROR: missing FROM-clause entry for table "pub2" at character 156
Statement: select * --count(*) from pub2.term_label where object_type_id = 4 and nm not in ( select nm from pub1.term_label where object_type_id = 4 ) order by pub2.nm limit 1000
Date: 2026-05-06 10:54:30 Database: ctdprd51 Application: pgAdmin 4 - CONN:4053406 User: load Remote:
13 1 FATAL: connection to client lost d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol
Times Reported Most Frequent Error / Event #13
Day Hour Count May 03 05 1 - FATAL: connection to client lost d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol
Statement: SELECT /* DiseaseGeneAssnsDAO */
Date: 2026-05-03 05:57:19
14 1 FATAL: FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (...) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (...) FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (...) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Times Reported Most Frequent Error / Event #14
Day Hour Count May 03 05 1 - FATAL: FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = ) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = ) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Statement: SELECT /* DiseaseGeneAssnsDAO */
Date: 2026-05-03 05:57:19
15 1 FATAL: END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (...) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (...) FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (...) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Times Reported Most Frequent Error / Event #15
Day Hour Count May 03 05 1 - FATAL: END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = ) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort d.nm diseaseNm ,d.acc_txt diseaseAcc ,d.acc_db_cd diseaseAccDbCd ,d.id diseaseId ,g.nm geneSymbol ,g.acc_txt geneAcc ,g.acc_db_cd geneAccDbCd ,g.id geneId ,gd.network_score networkScore ,gd.indirect_chem_qty inferredCount ,gd.reference_qty referenceCount ,gd.exposure_reference_qty exposureReferenceCount ,CASE WHEN gd.curated_reference_qty > 0 THEN (SELECT STRING_AGG(a.action_type_cd || '^' || a.action_type_nm, '|') FROM gene_disease_axn a WHERE a.gene_id = gd.gene_id AND a.disease_id = gd.disease_id) ELSE NULL END actionTypes FROM gene_disease gd INNER JOIN term g ON gd.gene_id = g.id INNER JOIN term d ON gd.disease_id = d.id WHERE gd.disease_id IN (SELECT p.descendant_object_id FROM dag_path p WHERE p.ancestor_object_id = ) ORDER BY actionTypes ,gd.network_score DESC NULLS LAST ,g.nm_sort ,d.nm_sort
Statement: SELECT /* DiseaseGeneAssnsDAO */
Date: 2026-05-03 05:57:19
16 1 ERROR: unterminated quoted string at or near "..."
Times Reported Most Frequent Error / Event #16
Day Hour Count May 06 11 1 - ERROR: unterminated quoted string at or near "'AC0ZRK%''" at character 52
Statement: select count(*) from pub2.term_label where nm like 'AC0ZRK%''
Date: 2026-05-06 11:15:50 Database: ctdprd51 Application: pgAdmin 4 - CONN:9784952 User: load Remote:
17 1 ERROR: subquery in FROM must have an alias
Times Reported Most Frequent Error / Event #17
Day Hour Count May 06 11 1 - ERROR: subquery in FROM must have an alias at character 63
Hint: For example, FROM (SELECT ...) [AS] foo.
Statement: SELECT SUBSTRING(nm, 1, 6) as pattern ,count(*) from ( select nm from pub2.term_label tl where object_type_id = 4 and nm not in ( select nm from pub1.term_label where object_type_id = 4 ) ) group by pattern order by count(*) descDate: 2026-05-06 11:21:11